KEGG   Alteromonas macleodii ATCC 27126: MASE_16375Help
Entry
MASE_16375        CDS       T02246                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00010  Glycolysis / Gluconeogenesis
amac00620  Pyruvate metabolism
amac00640  Propanoate metabolism
amac00680  Methane metabolism
amac01100  Metabolic pathways
amac01110  Biosynthesis of secondary metabolites
amac01120  Microbial metabolism in diverse environments
amac01130  Biosynthesis of antibiotics
amac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MASE_16375
   00620 Pyruvate metabolism
    MASE_16375
   00640 Propanoate metabolism
    MASE_16375
  Energy metabolism
   00680 Methane metabolism
    MASE_16375
Enzymes [BR:amac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MASE_16375
Lipid biosynthesis proteins [BR:amac01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MASE_16375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF1967
Motif
Other DBs
NCBI-ProteinID: AFS38769
Position
complement(3824404..3826350)
Genome map
AA seq 648 aa AA seqDB search
MTASKTYPVPENILQSTHLTASQYDEMYKQSVEQPEAFWAEHASMLEWYQKPTKIKNTMF
GENDVSIKWFEDGELNASYNCIDRHLADNATKVAFHWEGDSPEDSQDITYQQVHYEVCKL
ANALKEMGVAKGDRVAIYMPMVPEAAYAMLACARIGAVHSVIFGGFSPNAIADRINDSNA
KVVITADEGRRAGRSIPLKANVDKALSGDACPSITHVLVHKLTGGEVDWNAKHDVWWHDA
VDGVSAQCEPEVMNAEDPLFILYTSGSTGTPKGVVHTTGGYLLYSAMTFKYAFDYKEDDV
YWCTADVGWITGHSYMVYGPMVNAASQVFFEGVPTYPDVKRIAQVVEKYKVNSLYTAPTA
IRALMAHGDVPAEGCDVSSLRLLGTVGEPINPEAWEWYHRVIGMSRCPIIDTWWQTETGG
HMILPLPGATELKPGSATRPFFGIQPALFDADGNELEGAAEGNLVIKDSWPSQARTVYGD
HQRFINTYFSAYKGVYFTGDGARCDEDGFYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KVAEAAVVGFPHDIKGQGIYVYVTPNEGVEADEALTKELKAWVRQELSPIATPDMIQWSR
GLPKTRSGKIMRRILRKIAANEHEQLGDTSTLADPSVVDTLIEERLNK
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccagcaaaacttatcctgtgcctgagaacattcttcagtctacacatttaacc
gcatctcaatatgatgagatgtataagcaatctgtagagcaacctgaagcgttctgggct
gagcacgcatccatgcttgagtggtatcaaaagcccaccaaaattaaaaacacaatgttt
ggtgaaaacgatgtgtctattaagtggtttgaagatggtgaattaaatgccagctataac
tgtattgatcgccatttagctgataatgccacaaaagtcgcctttcactgggaaggtgac
tcaccagaagatagccaagatatcacgtatcaacaagtgcactatgaagtttgtaaatta
gcgaatgcacttaaagaaatgggcgtagcaaaaggtgatcgtgttgcgatttacatgccg
atggtacctgaggctgcctacgccatgctagcgtgtgcccgaattggtgcagtacattcg
gtgattttcggtggattttcacctaacgctattgccgatcgtatcaatgacagcaacgcc
aaagtcgtgattactgctgatgaaggccgtcgtgctggaagaagtattccactgaaagcg
aatgtggataaagcactgtctggtgatgcgtgtccgtctattactcatgttttagttcat
aagctcacaggaggagaagtagactggaatgctaagcacgatgtgtggtggcatgacgct
gttgatggcgtgtcagcgcagtgtgaaccagaggtaatgaacgcggaagacccactgttt
atcctttatacatcaggctctactggaacgccaaaaggtgtagtacacaccacgggcggg
tatctcttatattctgcgatgacctttaaatatgcctttgactacaaagaagacgatgtt
tattggtgtaccgctgatgtaggctggatcacaggccacagctacatggtttatggccct
atggtgaacgccgcatcacaagtgttctttgagggtgtaccaacctatccagacgttaag
cgtattgctcaggtagtggaaaaatacaaagtaaatagtttatataccgcgccaactgct
atccgcgcattaatggcccacggagatgttccagctgaagggtgtgatgtctcatcgctt
cgtctgttaggaacagtaggtgaacctattaatcctgaagcatgggaatggtaccaccgc
gtaattggtatgagccgttgtccaatcatcgatacatggtggcagacagaaacaggtgga
cacatgatcctgcctttacctggcgctacggagttgaagcctggctcagcgacccgtcca
ttcttcggcattcagcctgcgctatttgatgctgacggtaatgagcttgaaggggcagca
gaaggtaatcttgttattaaagacagctggcctagccaagctcgaacggtttatggcgat
catcagcgctttattaacacctactttagcgcgtacaaaggtgtgtacttcaccggtgac
ggtgctcgttgcgacgaagatggcttctactggatcaccggtcgtgtagatgacgtgcta
aacgtttctggacaccgtttgggcaccgctgaaatcgaaagtgcacttgttgcccatcct
aaagtggctgaggctgccgttgttggcttcccacatgatatcaaagggcagggtatctac
gtttacgtaacgccaaatgaaggggttgaagcagatgaagcccttactaaagagcttaag
gcgtgggtgcgtcaagagctaagcccgattgctacacctgatatgatccaatggtctcgc
ggattacctaaaacccgctctggtaaaattatgcgccgtattttgcgtaagattgccgcc
aatgagcatgagcaattaggtgacacatctacgttggcggatccatcggttgttgataca
ctgatagaggaacgtctaaataagtag

DBGET integrated database retrieval system