KEGG   Alteromonas macleodii ATCC 27126: MASE_16915Help
Entry
MASE_16915        CDS       T02246                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MASE_16915
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MASE_16915
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MASE_16915
Enzymes [BR:amac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MASE_16915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3967173..3968891
Genome map
AA seq 572 aa AA seqDB search
MDRRSFIKLSSLAGASVAVSTGLAGCTVSASANSQPQTNATFTHGVASGDPLKDAVIIWT
RAVPTSNLGSGSGSKSGLAKADILWEMASDADFANVISSGIVEAKAIHDFTVKVDVAGLS
PARRYFYRFKSANNTSPVGETRTLPEVDVSNVTFGIFSCSNYPAGFFTPYMEAAKDDNID
YVLHLGDYIYEYDGEGYATEHAKEIGRTYAPDNDTELYTLTDYRNRYALYRTDEGLLALH
QNKPFIVVWDDHEVTNDTYKDGAENHQADEGDFYERRAAAVQAYYEWLPIRPPFGTERLE
IYRQFTFGKLLDLYMLDTRVLARDKQLEYANYRDAETKAFDQARFMKDIGNPNRGLLGET
QRTWLHSSMQQSQAKWQVLGQQLLIGRMLFPVSIFNGVERKAIPDHVHRLANIKRKQKQG
GALSEQELALINTVMPYNLDAWDGYPVEREQVLMQLKSIGKPVIALAGDTHNAWHNKLTL
KDGTEVGVELATPGVTSPGMEHYLSMGDEKAKTLADDLPLLIEDLQYCNLHQRGFMTLTV
SQDSAKATWHYVDAILTKAGKVVNTHSYEIKA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggatagaagatcgtttataaagctgtcgtcactcgcaggcgcgagcgtagcagtgtct
acagggctagcaggctgtactgttagcgcttcagcaaacagccaaccgcaaaccaacgct
acctttacccatggtgtggcgagtggagacccattaaaagacgccgtgattatttggacg
cgcgccgtgcccacatcaaatttgggctcaggttcgggctcaaagtcaggtttagccaag
gccgatattttatgggaaatggcaagcgatgctgattttgccaatgtgataagtagcggt
attgttgaagccaaagcaatccatgattttaccgtaaaagtcgatgtagcaggacttagt
ccagctcgtcgttatttttaccgcttcaaaagcgctaataatacaagccctgttggagaa
acccgtacgctacctgaagtcgatgtgtctaatgtcacgttcggcatattttcttgttcc
aactaccccgctggctttttcacgccttacatggaagcagcgaaagacgacaacattgac
tatgtattacaccttggtgactacatttatgagtacgatggcgaaggttacgcaactgag
cacgccaaggaaattggcaggacctatgcgcctgataacgacacagagctttacactctc
actgactatcgcaaccgctatgcgctgtatcgcacggatgaaggcctgttggcattacac
caaaacaagccgtttattgttgtgtgggatgaccatgaagttacaaacgacacctacaaa
gacggtgctgaaaatcaccaagcggatgaaggcgatttttatgaacgtcgtgctgcggcc
gtgcaagcttattatgagtggttaccgatacgcccaccttttggcaccgagcgcttagaa
atttatcgtcagtttacctttggtaagcttcttgacttatacatgctcgacacccgcgtt
cttgctcgcgacaaacagcttgaatacgccaactatcgcgatgctgaaactaaagcgttt
gaccaagcacgctttatgaaagacatcggcaacccgaaccgcggtttactcggtgaaaca
caacgcacctggctccactcgtctatgcagcaaagccaggctaaatggcaggtgttaggg
caacagctattaataggccgtatgcttttccctgtatcgatttttaatggcgttgaacgc
aaagcaatacctgatcatgtacataggctcgcgaatatcaaacgcaaacaaaagcaaggt
ggtgcacttagtgagcaagagcttgcgcttatcaataccgtaatgccttacaacttagac
gcatgggatggctaccctgttgagcgggaacaggtgctgatgcagcttaagtccatcggc
aagccagttattgcccttgccggtgatacacataatgcttggcacaataaattaaccctt
aaagacggcacggaggtgggagttgaacttgccacaccaggcgtgacgtcacccggtatg
gaacattacctaagcatgggggatgaaaaagctaaaacccttgcagacgacctaccgctt
cttatagaagatttgcagtactgtaacctccaccagcgcgggttcatgactttaaccgtt
agccaagatagcgcaaaagcaacgtggcactatgtagatgcgattttgaccaaagcaggc
aaagtggttaatacgcatagctatgagattaaggcatag

DBGET integrated database retrieval system