KEGG   Alteromonas macleodii ATCC 27126: MASE_17345Help
Entry
MASE_17345        CDS       T02246                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MASE_17345
Enzymes [BR:amac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MASE_17345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4063479..4063976
Genome map
AA seq 165 aa AA seqDB search
MHKEHVYIGVGSNLGDSQGKAQRAFDAIGQIEDTRVLKTSSLYSSKPMGPQDQPDYINAV
CLIETSLKPHGLLKQLQRIELEEGRERKGERWGPRTLDLDILLYGSETIDTADLIIPHYG
MAEREFVMVPLFEIAPNMVMHDGKPISAWVANCSLDGLRRLRSSN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagagcacgtttacattggtgtaggtagcaacctcggcgatagccagggaaaa
gcccagcgcgcgtttgatgcgataggtcaaatagaagacacccgcgtacttaaaacctct
tcactttattccagtaaaccgatggggccgcaagaccaacctgactatattaacgcggtg
tgcttaattgagacctcgttaaagccccacggcttattgaagcagctgcaacgcatagag
ctggaagaaggccgtgagcgcaaaggtgagcgctggggaccacgcacgttggatttggat
attttgttgtacggcagcgaaactatcgacaccgcagacttaatcattccccattacggc
atggcagaacgcgagttcgttatggtgccgctgtttgaaattgcgcccaatatggttatg
cacgatggcaaacccatctcggcatgggtcgctaactgctcgctggatggacttcgtcgc
ctgcgctcttccaattag

DBGET integrated database retrieval system