KEGG   Alteromonas macleodii ATCC 27126: MASE_19010Help
Entry
MASE_19010        CDS       T02246                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MASE_19010
Enzymes [BR:amac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MASE_19010
Transfer RNA biogenesis [BR:amac03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MASE_19010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4456458..4457303
Genome map
AA seq 281 aa AA seqDB search
MPDDAHADLLELAKEIAIEAGEAVLEVYDKGEFDAYQKDDESPVTSADYLANDIINKRLQ
AATPDIPILSEENKHASLEERKHWPRYWLIDPIDGTQEFIARSGDFAVNIALIENNEPTI
GVIFWPPGQSLYYAQKGKGAFKSSPDGDHPISVRKLDDPKNSVVMIAISRRQSREKVLSR
MCAKRVYQTLPLGSCSLKACFIAEGKADVFMRIGITGEWDTGASQCIVSEAGGSIAAANF
EPLTYNQRHSLENPDFVVMGDQRVPWQDVVQYDDFVNPHQH
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgacgcccatgccgacctactagaacttgcgaaagaaattgccatcgaagcc
ggtgaagccgtattagaagtatacgataaaggggagtttgacgcttatcaaaaagacgat
gagtctcccgttaccagcgcagattatttggcaaacgatatcatcaacaagcgcttacaa
gccgcgacgcctgatatcccaatcctctcagaggaaaacaaacacgcaagtttagaagag
cgaaagcattggcctcgatactggttaatcgatcccatcgacggaacccaagaattcatt
gctagaagcggtgatttcgcagtaaacattgcgctaatagagaataatgagccgacaata
ggcgttattttttggccgccagggcagtcgctatattacgcccagaaaggcaaaggtgcg
tttaagtcatcacctgatggtgatcacccaataagcgtacgcaagctagacgaccctaaa
aatagtgtggtgatgattgcaataagccgtcgtcagtcgagagaaaaagtgctcagcaga
atgtgcgccaagcgcgtatatcaaacgcttccattgggaagctgttccctgaaagcctgc
tttattgccgaaggaaaagctgatgtgtttatgcgcatcggtattaccggcgaatgggac
actggcgcatcgcaatgcattgtttctgaagcgggtgggagtattgccgccgctaacttc
gaacctcttacctacaatcagcgtcattcgctagagaacccagattttgtggtaatgggc
gatcaaagggtgccatggcaagatgtagtccagtatgatgacttcgtaaacccacatcag
cactag

DBGET integrated database retrieval system