KEGG   Alteromonas macleodii Ionian Sea UM4b: I636_02145Help
Entry
I636_02145        CDS       T02723                                 

Definition
penicillin-binding protein 1B
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
amad  Alteromonas macleodii Ionian Sea UM4b
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:amad00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    I636_02145
Enzymes [BR:amad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     I636_02145
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     I636_02145
Glycosyltransferases [BR:amad01003]
 Polysaccharide
  Bacterial polysaccharide
   I636_02145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
476166..478526
Genome map
AA seq 786 aa AA seqDB search
MTKRQTKNNSSSKSNASKKTAAGKSTTKRSWFFKLFWRVCLIGLVVLGAYAFYLDAQIKH
AFSGNKWEVPAQIFARPLEVSKGEEITPQEVIDELNLLGYRKVAFADSSGEYSYQNKVLT
VQRRAFQFPEGAEPLRHLVLTWEGARIGEIYDKSQGRPYGSVKLEPWLVTRMTSGSHEDR
MLVTLDTIPEMLPKALTLVEDRNFYNHHGVAPLSILRALMANIAAGRTVQGGSTLTQQLV
KNMFLTRERSLVRKAKEAIMAVIIDARYSKSEIIEAYLNEVFLGQNGDMAVHGFGLASYF
YFDRPANELSTPEIATLVAIIKGPSYYNPRKYAERTKERRDLVLRMLFDENEINRQDYER
YVNMPLGLASGASLASGKHPAFMEQVRKELNEILAEPSLRDSGVKVFTTLDIVAQRRAEK
ALSGTLNGLQKDRSVPLQGAMVVTDSASGEVRAIVGGKDFAFKGFNRALDAKRPIGSLIK
PAVYLTALEDPTQFNLATPLKDEPITLESRNGTEWSPQNYDKEFRGQVPLLQGLVESLNV
PTVNLGMQIGLDALADTIERLGVTTPVDKVPSLTLGAFELTPFSTNQMYQTLSNDGRYIP
LHTVSSVVTADNALLWKKAEFFAQRTDEAATYLLNYALYKVTTEGTAKRIGWNFGNVNMA
GKTGTTDDYRDSWFSGFDRNNVVTVWVGNDDNQPVNLTGAGGALPVFVNYMKSQSPKSLS
RRFPKGLGIAHFDAKTGAVVVAGCAGSLSVPAILDVLPPAQQDCAGRPVDENGDKKEKSW
WERIFG
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaagacagactaaaaacaattcatcttcaaaaagcaatgcttcgaaaaaaact
gcagcgggaaaaagtacaaccaaacgttcgtggttttttaaactgttctggcgtgtatgc
cttatagggcttgtggtgctaggggcatatgccttttatctcgacgcacaaattaaacat
gcgttctcgggtaacaagtgggaagtacctgcgcaaattttcgcacgtcctttagaagtg
agtaaaggcgaggagataacgccacaagaagtcattgatgaactcaatttgctgggctat
cgcaaggtggcttttgctgacagtagcggtgaatatagctatcaaaacaaggtgttaact
gtgcagcgccgcgcgtttcaattccccgagggagcggagcctcttcgacacttagtatta
acgtgggaaggggcgcgtatcggtgaaatatacgataagtcacaaggccgtccctacggt
tctgtaaagttagagccatggctagtaacacgcatgacgagcggctctcatgaagaccgc
atgttagtgacgttagatactatccctgaaatgttacctaaagcgctgacgctggtggaa
gatcgcaatttttataaccaccatggtgttgcaccactttcaatattgcgggccctaatg
gcgaatattgctgctggtcgtacggttcaaggtggtagcacgctgacgcagcagctggtt
aaaaacatgtttttaacccgcgagcgctcccttgtacgcaaggctaaagaggccataatg
gcggtcattatagacgcccgctacagcaagtctgagattatcgaagcctatttaaatgag
gtgtttttagggcaaaacggcgacatggctgtacatggatttgggcttgctagctatttc
tactttgaccgtccggccaacgagctaagcacgcccgaaatagccacgctggttgctatt
atcaaaggcccatcttattacaatccacgaaagtatgcagagcgcacaaaagagcgtcga
gatttagtacttcgaatgttgttcgatgaaaatgaaataaaccgtcaagactacgagcgc
tatgtgaacatgccgttagggcttgccagcggtgcgagtttagcaagcggtaaacaccct
gctttcatggagcaggttcgcaaagaactcaatgaaattttagcagagccaagcctaaga
gactcgggcgttaaagtgtttaccacactggatatcgttgctcagcgtcgggcagaaaaa
gcattatcgggcaccctaaatggcctgcaaaaagatagaagcgttccattgcaaggtgcc
atggtagtcaccgacagtgcaagcggtgaagtacgcgctatcgtaggtggtaaagacttt
gcatttaaaggttttaatcgagcattagatgctaagaggccaataggctcattgattaaa
ccagctgtgtacttaactgccttagaagatcctacccagtttaacttggctacacccctt
aaagacgagccaattaccctagaaagtagaaacggcaccgaatggtcgccgcaaaactac
gataaagagttcagagggcaggtgcctctgcttcaggggttagtcgaatctttgaacgtg
ccaacagttaatttaggcatgcagataggcctagatgcgttagccgataccattgagcgg
ttaggggttaccacgccagtagataaagtaccgtcgttaaccttgggcgctttcgaacta
acgccatttagcacaaaccaaatgtatcaaaccctatcaaacgatggccgctacataccg
cttcacacggtgagctctgtggttacggcagataatgcattactttggaagaaggccgag
ttctttgctcagcgcacggatgaagccgccacttacttactgaactacgccctgtacaag
gtgaccacagaaggtacagcaaaacgcataggctggaactttggtaatgtaaatatggca
gggaaaacaggtacaaccgatgattatcgcgatagttggtttagcggtttcgacagaaat
aatgtggtgaccgtttgggtcggcaatgacgataatcaaccagtaaatttaaccggtgca
ggtggcgcgctgcctgtgtttgtaaattatatgaagtcacagtcaccgaagtctctatct
agacgtttccctaaagggttaggtattgcacatttcgatgcgaagacgggggcggtagtg
gtcgctgggtgcgcaggaagtttaagtgttccggctattttggatgtactgcctcctgcg
cagcaagattgtgctggtcgcccggtagacgaaaacggcgataagaaagaaaaaagctgg
tgggagcgtatatttggataa

DBGET integrated database retrieval system