KEGG   Alteromonas mediterranea UM4b: I636_02380Help
Entry
I636_02380        CDS       T02723                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
amad  Alteromonas mediterranea UM4b
Pathway
amad00380  Tryptophan metabolism
amad00630  Glyoxylate and dicarboxylate metabolism
amad01110  Biosynthesis of secondary metabolites
amad01130  Biosynthesis of antibiotics
amad01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amad00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    I636_02380
  Amino acid metabolism
   00380 Tryptophan metabolism
    I636_02380
Enzymes [BR:amad01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     I636_02380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: AGQ00352
Position
533010..534485
Genome map
AA seq 491 aa AA seqDB search
MSKCPFSGTAINPTTLTSSNGAPVANDNQSRTAGPRGPVTFDNHYLFEKLAHFNRERIPE
RVVHARGSAAYGTFTLTKSLSDYTIADFLQQEGQQTNVFLRFSTVGGGQDSSDYARDPRG
FSVKFYTEQGNWDMVGNNTPVFFLRDGIKFPDFIHSQKKNPRTNLPDPQAVYEFWANNPQ
SLHQSTILMSDRGIPLSYRHVNGYSSHTLSLWNKAGERYWVKWHFKTNQGIKTLTNEEAA
KMPAYGAQQDLVESIDNGDFPSWTVNVQIMTEEEARNYRINPFDLTKVWPHSDFSLIEVG
QLELNRNVENYFAETEQAAFAPSNLVPGIGVSPDRMLQARLIGYQDAHRYRIGANYNQIP
VNAPRCPVHNYQRDGAFAGVNPALAGSGANFYPNNRARVGEPAEAPEVQEPPMPLEQDAW
LDIYDNRDEDNYSQAGDLYRIMSEDQKQQLVNNIADGLSQATQDVQEAMFVQYDLADKDY
GARVRKAVASR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtgtccattttcaggtacagccataaaccctaccacgctaacgtctagcaat
ggtgcgcccgttgctaatgacaaccaaagtcgcaccgccggacctcgtggccctgttact
ttcgacaaccactatttattcgagaagcttgcgcactttaaccgcgagcgcattcctgaa
cgcgtagttcacgctagaggtagtgcagcgtatggtacttttacgcttactaagagttta
tccgattacaccattgccgactttcttcagcaagaaggacagcaaactaacgtctttcta
cgtttctctacagtaggtggtggtcaagattcaagcgactacgctcgcgacccccgtggt
ttttctgtgaagttttacaccgaacagggcaactgggatatggtgggcaataatacgcca
gtgtttttcttgcgagatggcattaagttccctgattttatacacagccagaaaaagaac
ccgcgaactaacttaccagatccgcaggcggtatatgagttttgggcgaacaatccgcag
tcattacaccaatcaacaattttgatgtcagatcgtggtattccgctgtcttatcgccac
gtgaacggctacagctctcatacattgagtttatggaataaagccggtgagcgctattgg
gtgaagtggcactttaaaactaatcaaggcatcaaaacgttaacgaatgaagaagcggcg
aaaatgcctgcttacggtgcgcagcaagaccttgttgaaagcattgataacggtgacttt
ccatcttggactgtaaacgttcaaattatgacggaagaagaagcgcgtaattaccgtatt
aacccgtttgacttaacaaaggtatggccacacagcgacttctcgttgattgaagtgggg
caactggagttaaatcgcaatgtggaaaattattttgcagaaacagagcaagcagcgttt
gcgccgagcaatttggtaccgggtattggcgtgtcgccagacaggatgctacaagcgcga
ctaattggatatcaagatgcgcacaggtaccgtattggcgctaattacaaccaaataccg
gtaaatgcgccacgctgtccagtgcacaattatcagcgtgacggtgcgtttgcaggcgtt
aatccagcacttgcgggaagtggagcaaacttctatccaaataaccgtgcgcgagttggt
gagccagccgaagcgccagaagtacaagagccaccaatgccgctagagcaagatgcatgg
ttagatatttatgataaccgtgatgaagacaactactcccaggcaggcgatttgtaccgc
attatgagtgaagatcagaaacagcagttggtaaacaatattgctgatggtctaagccaa
gctacacaagacgtgcaagaagctatgttcgtgcaatacgacttagccgataaagactac
ggcgcccgtgtaagaaaggcggtagccagcagatag

DBGET integrated database retrieval system