KEGG   Alteromonas macleodii Ionian Sea UM4b: I636_02380Help
Entry
I636_02380        CDS       T02723                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
amad  Alteromonas macleodii Ionian Sea UM4b
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amad00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    I636_02380
  Amino acid metabolism
   00380 Tryptophan metabolism
    I636_02380
Enzymes [BR:amad01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     I636_02380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
533010..534485
Genome map
AA seq 491 aa AA seqDB search
MSKCPFSGTAINPTTLTSSNGAPVANDNQSRTAGPRGPVTFDNHYLFEKLAHFNRERIPE
RVVHARGSAAYGTFTLTKSLSDYTIADFLQQEGQQTNVFLRFSTVGGGQDSSDYARDPRG
FSVKFYTEQGNWDMVGNNTPVFFLRDGIKFPDFIHSQKKNPRTNLPDPQAVYEFWANNPQ
SLHQSTILMSDRGIPLSYRHVNGYSSHTLSLWNKAGERYWVKWHFKTNQGIKTLTNEEAA
KMPAYGAQQDLVESIDNGDFPSWTVNVQIMTEEEARNYRINPFDLTKVWPHSDFSLIEVG
QLELNRNVENYFAETEQAAFAPSNLVPGIGVSPDRMLQARLIGYQDAHRYRIGANYNQIP
VNAPRCPVHNYQRDGAFAGVNPALAGSGANFYPNNRARVGEPAEAPEVQEPPMPLEQDAW
LDIYDNRDEDNYSQAGDLYRIMSEDQKQQLVNNIADGLSQATQDVQEAMFVQYDLADKDY
GARVRKAVASR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtgtccattttcaggtacagccataaaccctaccacgctaacgtctagcaat
ggtgcgcccgttgctaatgacaaccaaagtcgcaccgccggacctcgtggccctgttact
ttcgacaaccactatttattcgagaagcttgcgcactttaaccgcgagcgcattcctgaa
cgcgtagttcacgctagaggtagtgcagcgtatggtacttttacgcttactaagagttta
tccgattacaccattgccgactttcttcagcaagaaggacagcaaactaacgtctttcta
cgtttctctacagtaggtggtggtcaagattcaagcgactacgctcgcgacccccgtggt
ttttctgtgaagttttacaccgaacagggcaactgggatatggtgggcaataatacgcca
gtgtttttcttgcgagatggcattaagttccctgattttatacacagccagaaaaagaac
ccgcgaactaacttaccagatccgcaggcggtatatgagttttgggcgaacaatccgcag
tcattacaccaatcaacaattttgatgtcagatcgtggtattccgctgtcttatcgccac
gtgaacggctacagctctcatacattgagtttatggaataaagccggtgagcgctattgg
gtgaagtggcactttaaaactaatcaaggcatcaaaacgttaacgaatgaagaagcggcg
aaaatgcctgcttacggtgcgcagcaagaccttgttgaaagcattgataacggtgacttt
ccatcttggactgtaaacgttcaaattatgacggaagaagaagcgcgtaattaccgtatt
aacccgtttgacttaacaaaggtatggccacacagcgacttctcgttgattgaagtgggg
caactggagttaaatcgcaatgtggaaaattattttgcagaaacagagcaagcagcgttt
gcgccgagcaatttggtaccgggtattggcgtgtcgccagacaggatgctacaagcgcga
ctaattggatatcaagatgcgcacaggtaccgtattggcgctaattacaaccaaataccg
gtaaatgcgccacgctgtccagtgcacaattatcagcgtgacggtgcgtttgcaggcgtt
aatccagcacttgcgggaagtggagcaaacttctatccaaataaccgtgcgcgagttggt
gagccagccgaagcgccagaagtacaagagccaccaatgccgctagagcaagatgcatgg
ttagatatttatgataaccgtgatgaagacaactactcccaggcaggcgatttgtaccgc
attatgagtgaagatcagaaacagcagttggtaaacaatattgctgatggtctaagccaa
gctacacaagacgtgcaagaagctatgttcgtgcaatacgacttagccgataaagactac
ggcgcccgtgtaagaaaggcggtagccagcagatag

DBGET integrated database retrieval system