KEGG   Alteromonas macleodii Ionian Sea UM4b: I636_03705Help
Entry
I636_03705        CDS       T02723                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
amad  Alteromonas macleodii Ionian Sea UM4b
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
826509..827231
Genome map
AA seq 240 aa AA seqDB search
MKAVQKMLLAGAFAVGSLLSISTQAADEAAIRDKLTSMLGLDVETIADSPVSGLVQVSTN
RGLFYVSENGQYLLQARVFNIDEEMRNETELALSGLRKDGVKQMKSSSITFKAENEKYEI
SVFTDITCGYCRKFHNEIDELNDAGITVHYLAFPRSGLNSQNYDDMVSVWCAKDPQKALT
KAKAGSDVASASCKNKVAEQYMLGQKLGVNGTPNIVLPDGSLIPGYQPAKMLAKALAATE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcagtacagaaaatgttgttagccggcgcctttgccgtaggttctttgttgagc
ataagtacacaggctgcagatgaagccgccattcgcgacaagctaacctcaatgttaggg
ttagacgtggaaacgattgctgattcacccgtttcaggcttggtgcaagtctctactaac
cgcgggttattttatgtgagcgaaaacgggcaatacttgcttcaagcgcgggtttttaac
attgatgaagaaatgcgtaacgaaacagagcttgccctatcaggattgcgtaaagacggc
gtaaaacaaatgaagtcgtcgtcaattacgtttaaagcggaaaacgagaagtacgaaatt
agcgtgttcaccgatattacctgcggttattgccgtaaatttcataacgaaattgatgag
ttgaacgatgcgggcattaccgttcattatcttgcctttccccgttctggtttaaacagc
cagaattacgacgatatggtatcggtatggtgtgctaaagatcctcaaaaagcgctgact
aaagcgaaagcgggaagcgatgttgcaagcgcaagttgtaaaaacaaggtcgctgaacaa
tatatgctggggcaaaaattaggggtgaacggcacgccaaatattgtgttacctgatggt
tcacttatcccagggtatcaacctgctaaaatgttagcgaaggcattagcagcgacagag
taa

DBGET integrated database retrieval system