KEGG   Alteromonas macleodii Ionian Sea UM4b: I636_06095Help
Entry
I636_06095        CDS       T02723                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
amad  Alteromonas macleodii Ionian Sea UM4b
Brite
Enzymes [BR:amad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     I636_06095
Secretion system [BR:amad02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   I636_06095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1328791..1329483
Genome map
AA seq 230 aa AA seqDB search
MRKLSPFILALALSPFVQAEPVSEVSPVGKIDGMVSLPVTGMKAVESNNRIIFMSDSGRF
VIDGTLYDAWSKKPLTSLEEIREAGNTLDLSRLGLKMADLNPLTLGEGKKKVVVFVDPRC
PHCHELLKQALPLTKEYTFQILPVPVLGPDSERQVRQLGCARDKKAATDALLNGRIGNLE
QDDACNLEPMQRTLVTAQILGIQGVPFIVANDGRISRGRPYDLSAWLEGR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaactatctccatttattctggcgcttgcgctgtctccttttgttcaagctgaa
cctgtgtctgaagtgtcgcccgttggcaaaattgacggcatggtttctttacctgtcacg
ggtatgaaagcggtcgaaagcaataaccgtattatttttatgtcagacagtggccggttc
gtcattgatggcacgctctatgatgcctggtccaaaaagccgcttaccagccttgaagaa
attcgagaagcgggaaacacgctggacttaagtcgccttggcttaaaaatggctgatttg
aacccactgactttaggcgaaggcaaaaagaaagtggtggtctttgttgaccctcggtgc
ccacattgccatgagcttttgaaacaagccctgccgttaaccaaagaatacaccttccaa
attctccctgtgccagtgcttggtccagattcagagcgtcaggttcgccagcttggctgt
gcgcgtgacaagaaagcggccaccgatgcattgctgaatggccggattggtaacctagaa
caggatgatgcctgcaacttagaaccaatgcagcgtaccttggtgacggctcaaattctg
ggcattcaaggtgtgcctttcattgtcgccaatgatggtcgcatcagccgaggtcgtcct
tatgacctttctgcttggttggaggggcgttaa

DBGET integrated database retrieval system