KEGG   Alteromonas macleodii Ionian Sea UM4b: I636_09620Help
Entry
I636_09620        CDS       T02723                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
amad  Alteromonas macleodii Ionian Sea UM4b
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:amad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    I636_09620
  Amino acid metabolism
   00330 Arginine and proline metabolism
    I636_09620
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    I636_09620
Enzymes [BR:amad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     I636_09620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2152080..2153189
Genome map
AA seq 369 aa AA seqDB search
MSHPNWKRVVIKVGSALISPNQQGCSSHYLLSIAQFIVRCRANGTQVVLVSSGSVAAGAH
LFPEQEKSDIAVKKAMAAAGQTEMIATWDRLFDFPSAQMLLTHADLRDRERYVSIRETIF
SLLDNNILPIVNENDTVTTDKLKVGDNDNLSAMVASAAEADALIICSDIDGLYDKNPHEH
DDAKMLKSVDTIDQSIYDMAGGAVKGGVGTGGMRTKIEAAEKAVSHGIDTYIINGFTELS
FNMLLSGENPGTHFKPHAKPMQENVHWMRHTSNAQGEVIVEGDFDDSLHSDAEQLTSSEI
IDVKGEFSVGDTILVRKEDGTKLVKAKSNYSSCLLNFIANQENDEFAHEFEEKTGPIISD
QHIANLEKE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatcctaattggaaacgcgtagtcatcaaagtaggtagtgcattaatatcgccc
aaccagcaaggttgtagcagtcactatttgctgagtattgcacagtttatcgtgcgatgc
agagccaacggcacacaggtagtattggtgtcttctggctcagtcgcagctggcgcgcat
ttgtttccagagcaagaaaaatctgatattgcggttaaaaaagcaatggcagcagcaggc
caaaccgaaatgattgccacatgggacagactgtttgacttcccttcggcacagatgctt
ctaactcacgccgacttgcgcgacagagagcggtacgtgagtattcgtgaaacgatattt
agcttattggataacaatattctacctatcgtgaacgagaacgacacggtcactaccgat
aaattgaaagtaggtgacaacgataacttgtcagccatggtagcgtcggcagctgaagca
gacgcactgattatctgttcagacatcgatgggttgtacgataagaacccccacgaacat
gacgacgcaaaaatgctcaagtcggttgataccatcgaccaaagcatttatgacatggct
ggtggtgcggttaaaggcggtgtaggcaccggcggcatgcgcacaaaaattgaagcggcg
gaaaaagccgtttcgcatggtatagatacatatattattaacggctttactgagctgtcg
tttaacatgctgttgtcgggtgaaaacccgggtacgcatttcaaacctcacgccaagcca
atgcaagaaaatgtgcattggatgcgccatacttcaaacgcgcagggcgaggttatagta
gagggagatttcgatgactctctacacagcgacgcagagcagcttaccagcagcgaaatt
attgacgtgaaaggtgagttctcggtcggcgacaccatattagtacgtaaagaagacggt
actaagctggtgaaagcgaaatcgaattacagtagctgtttattgaatttcattgcgaat
caggaaaacgacgaatttgcccacgagtttgaagaaaaaacggggccaattatttctgat
cagcacatagcaaatctggagaaagaatga

DBGET integrated database retrieval system