KEGG   Alteromonas macleodii Ionian Sea UM4b: I636_11705Help
Entry
I636_11705        CDS       T02723                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
amad  Alteromonas macleodii Ionian Sea UM4b
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amad00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2631838..2634030)
Genome map
AA seq 730 aa AA seqDB search
MHLAQQFEQVTCSQPFSHLGVIASQQGAMLRVWCPDASEVTIKWENSALADRVIKSDNAN
GLFEASLPAEYNGEIYRVVANKGRGDNGYIDPYQFTEQAYHAVHYIDSTPANLYEQAGAQ
LIDISTPQGKTVSGVRFCVFAPNASAVSLIGDFNQWDGRTHPMEKTSMGYWVLFVPELTE
GERYKYHIKDANGHDLPHKADPLGFCAEQYPSHASKIYNHRSYQWSDSDWMENRKGDKYA
SPMSIYEVHLGSWKRPDAATEARYLTYKELADDLIGYVSDMGYTHVELLPISEFPFDGSW
GYQPVGMFAPTSRFGNPDDFKYFVDKCHQAGVGVIIDWVPAHFPEDGHGLARFDGSCVYE
YEDPRKGWHPDWNSCIYDFGKDTVRQFLVANALYWLDKFHVDGLRVDAVASMLYLDYSRN
EGEWIPNVDGGNENYEAISLLKWMNEEVYKHFPDAMTIAEESTSFPKVSRPVFDGGLGFG
FKWNMGWMHDSLHYIAKDPAYRNYHHGDITFSMVYAFDENFVLPISHDEVVHGKGSMLHK
MPGDEWQQAANLRCYAGFMYGHPGKKLNFMGNELAQAREWNHDSSLDWHLLDFEKHAGIQ
ALYKALNHLYTSIPALYEQDHDPAGFAWLDHSNADQSVVSFVRTSKDAKQKVYVVSNFTP
VPRKNFRIGVDEACTLTLALNTDDGAYWGSNYEVVANTTAQLVPWNDRTHSVEITLPPLA
TVFYVADLSE
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgcatttagcgcagcagttcgaacaagtaacatgttcccaaccattttctcatcttggc
gtcattgccagtcaacaaggtgcaatgcttcgtgtttggtgtcctgacgccagcgaagta
acgattaaatgggagaattctgcgctagctgatcgagttattaaatcggacaatgcgaat
ggcttatttgaagcgtcacttcccgctgagtacaacggtgaaatttaccgcgtagtcgct
aataaggggagaggggataatggttatatcgacccttatcaatttactgaacaggcttac
catgccgtacattatatcgatagcacgccagcaaatttgtacgaacaagcgggtgcgcag
ttaattgatatctctacaccacagggcaagacggtaagtggcgtgaggttttgtgtattt
gcgccaaatgcaagcgcggtatcactcattggcgatttcaaccagtgggacggacgtact
cacccgatggagaaaacgtcgatggggtattgggtgctcttcgtacccgagctcactgaa
ggcgaacgctataaatatcatatcaaagacgccaatggtcatgatttaccgcataaagct
gaccccttaggattctgtgctgagcagtatccttctcatgcgtcgaaaatttataatcac
cgttcctaccagtggagcgatagtgattggatggaaaatcgcaagggggataaatacgcc
agccctatgagcatttatgaggttcacttaggctcatggaaacgacctgacgctgctaca
gaggcgcggtatcttacctataaagaacttgccgatgatttgattggttacgttagcgat
atgggctacacccatgtggaactgctaccaatatcagagtttcctttcgacggctcgtgg
ggataccaaccggtaggtatgttcgcgcctaccagtcggtttggcaatccagatgacttc
aaatactttgtcgataaatgtcaccaagccggcgtgggcgttatcatcgattgggtacct
gctcattttcctgaagatggacacggtctggcaaggtttgacggttcgtgtgtgtatgaa
tatgaagaccctcgtaaaggctggcacccagattggaactcatgtatctatgactttggc
aaagataccgttcgtcaatttttagttgccaatgctctttactggcttgacaagtttcac
gtggacggacttcgggttgatgcggtagcgtctatgctttatttagattactcccgcaac
gaaggcgagtggatcccgaacgttgacggcggtaatgaaaattacgaagcgataagcctg
cttaaatggatgaacgaggaagtatacaagcacttcccagacgctatgactatagcggaa
gagtccacgtcatttcccaaagtatctcgccctgttttcgacggtggcttaggctttggc
tttaaatggaacatgggctggatgcacgactcgctgcactacattgcaaaagaccctgca
tatcggaattaccaccacggtgatattacgtttagcatggtttatgcctttgatgaaaat
tttgttttacccatttcccatgatgaagtcgtacatggtaaaggcagcatgttacacaag
atgccgggcgatgagtggcaacaagccgctaatttgcgctgttacgcaggtttcatgtat
ggccatccaggcaagaagcttaacttcatgggtaacgaactggcgcaagcacgggaatgg
aatcacgatagcagcttagactggcacttgcttgacttcgaaaagcacgcaggtattcaa
gcgctgtataaggcgttaaaccatttgtacacctcaatcccagccctttatgaacaagac
catgacccggcgggttttgcgtggcttgatcacagcaatgcggatcaaagcgttgtgtcg
tttgttcgcacttcaaaagatgcaaagcaaaaagtctacgtggtgtctaactttacacct
gttccgcgcaagaactttagaattggtgtggatgaagcctgcacgttgacgctggcgctg
aacaccgacgatggggcttattggggtagcaactacgaagtcgttgccaacacaaccgca
caacttgttccgtggaatgatcgtacacattcagtagagataaccttaccgccacttgct
acggtgttttacgttgctgatttgagtgaatga

DBGET integrated database retrieval system