KEGG   Alteromonas macleodii Ionian Sea UM4b: I636_13865Help
Entry
I636_13865        CDS       T02723                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
amad  Alteromonas macleodii Ionian Sea UM4b
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:amad00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3125687..3126268
Genome map
AA seq 193 aa AA seqDB search
MAQLYFYYSAMNAGKSTSLLQSAYNYRERGMHSIIYTAALDDRYGVGKVTSRIGLQADAK
LYSKDDDLFTSIRLDCEKRKPDCVFIDEAQFLTKAQVRQLVEAVDELDVPVLAYGLRTDF
LGETFEGSHYLLAWADKLFELKTVCHCGRKANFVVRLDENGNAVKNGDQVQIGGNDTYES
MCRKHFKALVWDE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaactttatttttactactctgcgatgaacgcggggaaatcgacatcacttctt
caatcagcatacaactatcgcgaacgcggtatgcactctatcatatacactgcagcgcta
gacgaccgttacggtgtgggaaaagtcacctctcgaattgggttacaggccgacgccaag
ctgtattcgaaagacgacgacctgttcacgtcaattcgactagactgtgaaaagcgtaaa
ccggattgtgtgtttatagatgaggcacagtttttaacaaaggcgcaagtcaggcagctc
gtagaagcagtcgatgaattggatgttccagtacttgcttacggcctgagaactgacttt
ttaggggaaacctttgaaggcagccattacctgcttgcttgggctgacaaactgttcgaa
ttgaaaaccgtttgtcactgcggccgaaaagctaactttgtagtcaggctagatgaaaat
ggtaatgcagttaaaaatggcgaccaagttcaaattggcggtaatgacacgtacgagtct
atgtgcagaaaacattttaaagcgctagtttgggatgagtaa

DBGET integrated database retrieval system