KEGG   Alteromonas mediterranea UM4b: I636_16365Help
Entry
I636_16365        CDS       T02723                                 

Definition
(GenBank) endoglucanase Y
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
amad  Alteromonas mediterranea UM4b
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3690120..3691220)
Genome map
AA seq 366 aa AA seqDB search
MVTGFKATKTLLAIALTLLLVSCSTKEDNAFKSQFMAYKALFIDGGRVVDTGNDEVSHSE
GQGYGMLFAVAADDKDTFDALWHWTQRTLLRSDGLFSWRYRPCADNSESCIDDPNNASDG
EILIAWALLRASEKWGIKGYQDEAGKIVQAVEQKLLVEHQGGVMLLPGEYGFTSQSEGQK
SLQLNLSYWVFPALTDLSALSNTPSRWQKLHQTGLTLLSNMQFSSYQLPSDWVRFEPRNS
GSAKSGLSGELTLTNVVSAEFGFNAIRIPLQLAWSEQVRDNAALAEELFAPYYQWWAKTP
TPATVNLLTEQTAEYEMTPGMQSVKLAVKYLMKSEEPVWPTVNRKMDYYSASLTLLSMLA
VSDNAS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccggatttaaggcaacaaaaacgctgctggcgatagcactaaccctattgtta
gtgtcgtgctccacaaaagaagacaatgcttttaaatcgcaatttatggcgtataaagcg
ctatttatcgacggcgggcgtgtggtagatacgggaaacgatgaggtgtcgcacagcgaa
gggcaaggttacggcatgttattcgctgtagcagccgacgacaaagataccttcgatgcc
ctatggcactggacccagcgcacgcttttgcgcagcgatgggcttttcagctggcggtat
cgcccatgtgccgataattcggagtcgtgtatagacgacccgaataatgcatcagatggc
gagattttaattgcatgggccttgttacgggccagtgaaaaatggggaataaagggatat
caagacgaagcgggtaagattgttcaggctgtagagcaaaagctgttggtagagcatcaa
ggtggcgtgatgttactacctggtgagtacggcttcacctcacaaagcgaggggcaaaag
agcctccagcttaatctgtcatactgggtttttcccgcacttacagatttatctgcctta
tccaatacaccgtcgcgatggcaaaagctccatcaaactgggcttactttgctttcgaac
atgcaattttcatcctatcaactgccaagcgactgggtgcgttttgaaccccgcaatagt
ggttcagcaaagtcagggttatccggtgagctcaccctaaccaacgtggtatctgcagag
tttggctttaacgctattcgcattccgctgcagttggcatggtccgaacaggttcgagac
aacgcggcattagccgaagaactttttgcgccctattatcaatggtgggctaaaacgcct
actccagccactgttaatctacttaccgagcaaaccgctgaatatgagatgacacccggc
atgcagtcggtgaagttagccgtcaagtaccttatgaaatctgaagaaccagtgtggcca
acagttaatcgcaagatggactattactcggccagtttaacgctgctctctatgctagcg
gtgtcggataacgcatcgtga

DBGET integrated database retrieval system