KEGG   Alteromonas macleodii Ionian Sea U7: I876_02515Help
Entry
I876_02515        CDS       T02721                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
amae  Alteromonas macleodii Ionian Sea U7
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:amae00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:amae00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
608731..610206
Genome map
AA seq 491 aa AA seqDB search
MSKCPFSGTAINPTTLTSSNGAPVANDNQSRTAGPRGPVTFDNHYLFEKLAHFNRERIPE
RVVHARGSAAYGTFTLTKSLSDYTIADFLQQEGQQTNVFLRFSTVGGGQDSSDYARDPRG
FSVKFYTEQGNWDMVGNNTPVFFLRDGIKFPDFIHSQKKNPRTNLPDPQAVYEFWANNPQ
SLHQSTILMSDRGIPLSYRHVNGYSSHTLSLWNKAGERYWVKWHFKTNQGIKTLTNEEAA
KMPAYGAQQDLVESIDNGDFPSWTVNVQIMTEEEARNYRINPFDLTKVWPHSDFPLIEVG
QLELNRNVENYFAETEQAAFAPSNLVPGIGVSPDRMLQARLIGYQDAHRYRIGANYNQIP
VNAPRCPVHNYQRDGAFAGVNPALAGSGANFYPNNRARVGEPAEAPEVQEPPMPLEQDAW
LDIYDNRDEDNYSQAGDLYRVMSEDQKQQLVNNIADGLSQATQDVQEAMFVQYDLADKDY
GASVRKAVASR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtgtccattttcaggtacagccataaaccctaccacgctaacgtctagcaat
ggtgcgcccgttgctaatgacaaccaaagtcgcaccgccggacctcgtggccctgttact
ttcgacaaccactatttattcgagaagcttgcgcactttaaccgcgagcgcattcctgaa
cgcgtagttcacgctagaggtagtgcagcgtatggtacttttacgcttactaagagttta
tccgattacaccattgccgactttcttcagcaagaaggacagcaaactaacgtctttcta
cgtttctctacagtaggtggtggtcaagattcaagcgactacgctcgcgacccccgtggt
ttttctgtgaagttttacaccgaacagggcaactgggatatggtgggcaataatacgcca
gtgtttttcttgcgagatggcattaagttccctgattttatacacagccagaaaaagaac
ccgcgaactaacttaccagatccgcaggcggtatatgagttttgggcgaacaatccgcag
tcattacaccaatcaacaattttgatgtcagatcgtggtattccgctgtcttatcgccac
gtgaacggctacagctctcatacattgagtttatggaataaagccggtgagcgctattgg
gtgaagtggcactttaaaactaatcaaggcatcaaaacgttaacgaatgaagaagcggcg
aaaatgcctgcttacggtgcgcagcaagaccttgttgaaagcattgataacggtgacttt
ccatcttggactgtaaacgttcaaattatgacggaagaagaagcgcgtaattaccgtatt
aacccgtttgacttaacaaaggtatggccacacagcgacttcccgttgattgaagtgggg
caactggagttaaatcgcaatgtggaaaattattttgcagaaacagagcaagcagcgttt
gcgccgagcaatttggtaccgggtattggcgtgtcgccagacaggatgctacaagcgcga
ctaattggatatcaagatgcgcacaggtaccgtattggcgctaattacaaccaaataccg
gtaaatgcgccacgctgtccagtgcacaattatcagcgtgacggtgcgtttgcaggcgtt
aatccagcacttgcgggaagtggagcaaacttctatccaaataaccgtgcgcgagttggt
gagccagccgaagcgccagaagtacaagagccaccaatgccgctagagcaagatgcatgg
ttagatatttatgataaccgtgatgaagacaactactcccaggcaggcgatttgtaccgc
gttatgagtgaagatcagaaacagcagttggtaaacaatattgctgatggtctaagccaa
gctacacaagacgtgcaagaagctatgttcgtgcaatacgacttagccgataaagactac
ggcgccagtgtaagaaaggcggtagccagcagatag

DBGET integrated database retrieval system