KEGG   Alteromonas macleodii Ionian Sea U7: I876_08030Help
Entry
I876_08030        CDS       T02721                                 

Definition
Kynureninase
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
amae  Alteromonas macleodii Ionian Sea U7
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amae00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    I876_08030
Enzymes [BR:amae01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     I876_08030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1834637..1835872
Genome map
AA seq 411 aa AA seqDB search
MINKVFSSEQLDDKDPLAHKAGAFSLPDNTIYLDGNSLGPLTKSAEKRAVEVVQEQWGQG
LITSWNKHQWISLPQQVGDKIGELIGAQQGQVICCDSISINLFKVLSAALKMNPRRKVIA
TTRDNFPTDIYMVQGLLDLLGEEYSIRYVDEASISSQLTDDIAVLMLTQVNFRSGLKLDM
KGITEQAHAKGILTLWDLAHSAGAFPVCLDDCNVDFAVGCSYKYLNGGPGAPAFIYVARR
HQDSYQQPLSGWMGHSAPFSFSPDYAPDSSVKQNLCGTPGVIGMSILDAALDVFDDVSLK
AIDEKSKKLQAFFIAEAKRAGVLEHFGVASPPINCRGSQLALAHDEAYAICQAWIAEGVI
ADFRAPNILRIGFAPLYLSFADVEKAVTRLAIIMNEKRYENATFQQRQSVT
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaggttttttcctctgagcaacttgatgacaaggacccgcttgcacataaa
gctggggctttttcgcttccagacaacaccatctatttagacggtaattctcttggccct
ttaacgaaatcagcagaaaagcgagcggttgaagtagttcaagagcaatgggggcaaggc
cttattacaagttggaacaaacaccagtggatttccttacctcaacaagtcggcgacaaa
ataggggagcttataggcgcgcaacagggccaggtcatctgttgtgactctatctctatt
aacttatttaaagtgttaagcgccgcgcttaaaatgaacccaaggcgcaaagtaattgcg
accacacgtgataattttccaaccgatatctatatggttcaagggttgttagatttactt
ggcgaagagtacagtatccgctatgtagatgaagccagtattagtagccagttaactgat
gatattgccgtgcttatgcttacgcaggttaactttcgaagtgggcttaagcttgatatg
aaaggcattaccgagcaagcacatgcaaaagggattttgacgttgtgggatcttgcccat
agtgccggtgctttcccagtatgcttggatgattgcaacgtagattttgccgtagggtgt
tcgtacaagtatttaaacggcggccccggcgcgccagcatttatttatgttgcgcgccgt
catcaagatagctatcagcagcccctgtctggatggatgggacacagtgcccctttttca
ttttctcccgactacgcgccagatagctcggtaaagcaaaacttgtgcggtacgcccggt
gttataggcatgagtatattagatgcggcattagacgtttttgacgatgtgtcactgaaa
gccatcgacgagaagtcgaaaaagcttcaagctttttttattgctgaagcaaaaagggca
ggggtgttagaacatttcggtgtggcgagcccaccgattaattgccggggtagccagtta
gccctcgcccacgatgaggcttatgccatttgccaagcgtggattgctgaaggggtgatc
gctgacttccgcgcacctaatattttgcggatagggtttgcgccgctttatttgagcttc
gccgatgtcgaaaaggcggtaacaaggcttgcaataatcatgaacgaaaaacgttatgaa
aatgcgacattccagcaaagacagagcgttacctga

DBGET integrated database retrieval system