KEGG   Alteromonas macleodii Ionian Sea U7: I876_12030Help
Entry
I876_12030        CDS       T02721                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
amae  Alteromonas macleodii Ionian Sea U7
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    I876_12030
   00500 Starch and sucrose metabolism
    I876_12030
Enzymes [BR:amae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     I876_12030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2720439..2721641
Genome map
AA seq 400 aa AA seqDB search
MNIIKARNDVYKAFALMAGILFTGCCLAMPAGTDIVVVKSRTNEAVDTSENASPHQFQTV
NQAVAYVESQAQQQGKIWTIFVKEGTYRERVVIALDNLRIVGESRDATTIVFSRYAGQKV
SDGSEEKWGTRRTATVEIVGNNVTIENITITNDFDYPGNEVKAKDDPTRLSGTQAVALKT
DVNSDRTYLNNVALWGYQDTLYLKGDRALIEGGIIAGHIDFIFGEGTAFFDGVTILSRAR
FSDGDAEGLTGYITAPSTHLQRPYGFTFHNCKLEREDGVPDMSVALGRPWHPTTSFSDGR
YANPYAVGKATFINTYMSGHITQARWTTMGGTIPSGEKRPFSPHTEARFSEYQSHGEGAH
DRATTPAMESHFLDANAAAFYTKEAVLRGWKPDTTMYNIK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaacattatcaaagcgcgtaacgatgtttataaagcctttgcgctaatggcgggtatt
ctattcactggttgttgtctagcaatgcctgctggtacagatattgtagttgtgaaatca
cgtaccaatgaagctgttgatacgtcagaaaatgcatccccccatcagtttcaaacggtt
aaccaggctgtggcgtatgttgaatctcaagcacaacagcagggcaaaatttggactatt
ttcgtaaaagaaggcacctaccgagaacgggttgtgatcgccttagataatcttcgtatc
gttggtgaatcgcgagatgcaacaactatcgtatttagccgatacgcagggcaaaaggtc
tcagacggttctgaagaaaaatggggaacccgtcgcaccgccacggtggaaatagtagga
aataatgtcaccatagaaaacatcactatcaccaacgattttgattatcccggtaacgag
gttaaagcaaaagatgacccgactcgcctctcaggtacacaagcggtagcacttaaaaca
gacgttaattcagatcgcacttatcttaacaacgtcgcgctatggggttaccaagacacc
ctttatttgaaaggtgaccgcgctctgatagaaggcggaataatagcaggacatatagat
tttatttttggggaaggcacagcattttttgatggcgtcacaattctttcaagagctcgt
ttttccgacggcgatgccgaaggactcactggttacattactgcaccaagtacgcactta
cagcggccatatggattcacattccataactgcaagctagaaagagaagatggtgtgcca
gatatgagcgttgcactaggaagaccttggcatccaacgaccagcttttctgacggccgc
tatgccaatccttatgcggtaggcaaagccacatttataaacacctacatgtcaggacat
attacgcaagctcgttggactaccatgggcggcactatcccatcgggagaaaaaaggcca
tttagtcctcacaccgaagccaggttttctgaataccaatctcatggtgaaggtgcccac
gacagagctactacacctgcaatggagtctcattttctagacgccaacgctgcagctttt
tacaccaaagaggcggtattgcgaggctggaagccggataccacaatgtacaatattaaa
tag

DBGET integrated database retrieval system