KEGG   Alteromonas macleodii Ionian Sea U7: I876_12185Help
Entry
I876_12185        CDS       T02721                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
amae  Alteromonas macleodii Ionian Sea U7
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    I876_12185
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    I876_12185
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    I876_12185
Enzymes [BR:amae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     I876_12185
Exosome [BR:amae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I876_12185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2759483..2761405
Genome map
AA seq 640 aa AA seqDB search
MNLFKLSIIAVAVAGLSACSLEGDDGNDGAPGADGADGQNGLTSLTVQTELAVGDANCPN
SGVRIDSGLDADADGTLGDSEITSTSYVCVPGVNSVSNSELLTSLNNEWFVSAQNEVENN
KAVWMNATSGESAASSNASFTVTANSQEELKAMVASLRGKAKNVILFVGDGMGVSTVTAA
RILDGQMNGLAGEENQLSFDKFPFSGLSKTYNVDAQTPDSAGTMTAMMSGIKTDVGVIGV
DEDIERGDCSTVAGNELVTALELAEIAGKSTGIISTARITHATPAATYAKSADRNWEDIS
DMPEDAVTAGCSDIADQLVNFEANLEANFEGLDVDGLEVVMGGGRRHFLPRDEAFNSPDA
ASSVEGDRTDGRDLTAEWQAMYENGVYIYDQSGFDGLDTETTERVFALFNESHMQYEADR
GNDIAGEPSIAEMTSAAIKVLDNNEEGFFLMVESGRIDHAHHAGNAYGALHDTIAFAEAV
DAADKLTDDEDTLIIVTADHGHVFTIAGYPKRGNPILGKVVNVGSDEAATAADGTPYTTL
GYTNGLGFRNLGDVTNSDAAYLEGPDTGRKDITDVDTTTPGYHQEALIPLGSETHSGEDV
GIYAKGPGAFLVNGTNEQSVIFHVMDFAGDFVSQAENAME
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaacctttttaaattaagtataattgcggtagcagtagcaggtctttcagcgtgtagc
ttggaaggcgacgatggtaacgatggcgcaccaggtgctgatggcgctgacggtcaaaac
ggtttaacaagccttaccgtgcaaacggaattagcggttggcgatgctaactgccctaac
tcgggtgttcgcattgactcaggcttagacgccgatgctgacggcacacttggtgatagt
gaaattacttcgacaagctatgtttgtgttcctggcgtaaacagcgtgagcaatagcgaa
ctactcactagcctcaataatgagtggtttgtgtctgctcaaaacgaagtggaaaacaat
aaagcggtttggatgaacgcaacatcgggtgaaagtgcagcgtcatcgaacgcgtctttt
actgtcactgcaaattcgcaagaagaattaaaagccatggtagcgagcctgcgcggtaaa
gcgaaaaacgttatcttgtttgtcggtgacggcatgggcgtttctaccgttaccgcagcg
cgtattctagatggtcagatgaacggcctagcaggcgaagaaaaccagcttagctttgac
aaatttccattctccgggctttcaaaaacttataacgttgatgcccaaacaccggattct
gcaggcacaatgaccgctatgatgagcggcataaaaactgacgtaggtgttatcggcgta
gacgaagatattgagcgcggtgattgttctaccgttgcaggtaacgagttagttacggcg
ctagaactcgctgaaattgcaggtaagtctaccggtattatttctactgcccgtattacg
cacgccacgccagcagcaacctatgcaaagtcagcagatcgcaactgggaagacatttca
gatatgccagaagatgcggttacagcgggttgttctgacattgccgaccagttggttaat
ttcgaagctaacttagaagcgaactttgaaggcctggacgttgatggtcttgaagttgta
atgggtggcggacgtcgccacttcttgccgcgtgacgaagcatttaacagccccgacgct
gcgagcagtgtagaaggcgatcgtacagatggacgtgatttaacggccgagtggcaagca
atgtacgaaaacggggtttatatctatgatcaatctggtttcgacggcttggatactgaa
accactgaaagagtattcgcgttattcaacgaatcacacatgcaatacgaagccgaccgc
ggcaacgacattgctggtgaaccttctatcgctgaaatgacaagtgcagcaattaaagtg
ttagataacaatgaagaaggtttcttccttatggttgaatccggtcgaatcgaccacgct
caccacgcaggtaatgcttacggggcacttcatgacactatcgcttttgctgaagctgtt
gatgctgctgacaagcttactgatgatgaagatacacttattattgtaaccgctgaccac
gggcacgtctttaccattgctggttatccaaagcgcggcaaccccattttaggcaaggta
gtaaacgtaggttcagatgaagctgctacagctgccgacggtacgccatacaccacactt
ggctacacaaatggcctaggttttagaaatctgggagacgttactaactcagacgcagct
tatttagaaggccctgatacaggtcgtaaagacatcactgatgtcgacactacaacacct
ggctatcaccaagaagccttaattccactgggttcggaaacacactcgggtgaagatgta
ggcatttatgctaaaggccctggcgctttcctcgtcaacggtactaatgagcaaagcgtt
atattccatgttatggattttgcaggggactttgtctctcaagcagaaaatgcaatggaa
taa

DBGET integrated database retrieval system