KEGG   Alteromonas macleodii Ionian Sea U7: I876_12235Help
Entry
I876_12235        CDS       T02721                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
amae  Alteromonas macleodii Ionian Sea U7
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:amae00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:amae00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2770702..2772771)
Genome map
AA seq 689 aa AA seqDB search
MAESFKYEGNKGQGGELHQKAGDGYPTMTTAQGCPVHDDQNSLKAGVRGPSALEDHVMRE
KIFHFDHERIPERVVHARGYGAHGYFETYESLSDITCAEIFQEKGKKTPVFTRFSTVAGN
QGSPDLARDVRGFAVKFYTQEGNWDLVGNNIPVFFIQDAIKFPDLIHSAKQEPDRGFPQA
QTAHDNFWDFTSLSPESVHMLMWAMSDRAIPRSFRFMEGFGVHTFKLINAKGEMKYVKFH
WKPKQGLQSVVWNEALKINGADPDFHRRDLWNAILAGDFPEWELGMQVFDQEFADNFEFD
VLDATKLIPEEQVPVKIVGKMVLNKVVDNFFAETEQVAFCTQNIVPGIDFTNDPLLQGRN
FSYLDTQLKRLGSTNFTHLPINAPKCPMRHFQQDGHMAMHNPKGRANYEPNSWEADENNP
RACPEHGFQSHNEEVSGEKVRHRSETFADHYSQARQFYISQTETEKEHIRDAFAFELSKV
ERLAIRERVVSHLLNVDKDLAKAVGEALGFSEMPEPAEAAMETREDLVESDALSILKNAP
DTFKGRKLGILVSDDLDGELLGKVKTALDNEGAMYEVVAPQIGGVTCDKGKKVDAQQKVD
GGPSVLYDAVLLLMSQSGAEKLAGKPEAKDFVSDAFAHNKFIGYTDAAMPLIKAVGLDSM
IDEGFVDLKQKSADEFIKTLRGIRYWARS
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatcattcaagtatgaaggaaataaaggacaaggcggcgaattacatcagaag
gctggcgacggttaccctacaatgacaaccgcgcagggttgtcctgtacacgatgaccag
aattcactaaaagctggagtaagagggccttcagctctagaagatcacgtgatgcgtgag
aagatatttcactttgatcacgagcgcattcccgagcgcgtggtgcatgctcgagggtac
ggggcccacggatattttgaaacgtacgagtcactatctgacatcacctgtgctgaaatt
tttcaggaaaaaggtaaaaagaccccggtattcactagattctctaccgtagcgggcaac
cagggttctccagatttagcgcgcgatgtacgaggttttgctgttaaattctatactcaa
gagggcaattgggatttagttggcaataacattcccgtcttctttattcaagatgctatc
aagttcccagatttaattcactcagctaaacaagagcctgaccgaggttttccacaagcg
caaaccgcgcacgataacttttgggacttcacaagcttaagcccagagtctgttcacatg
cttatgtgggcgatgtcagaccgtgctattccgcgttcattccgcttcatggaaggtttt
ggtgtacacacctttaagcttataaatgccaaaggtgaaatgaaatatgtgaagtttcat
tggaaaccgaaacaaggtttgcagtcagtcgtgtggaatgaagcactgaaaattaatggt
gcagatcccgatttccacagaagagacctttggaatgcaatacttgctggcgacttccca
gaatgggagttaggaatgcaagtcttcgaccaagagtttgcggacaactttgaattcgat
gttttagacgcaaccaagctgatacccgaagagcaagtaccagttaaaattgtaggtaaa
atggtgcttaataaggtggtagacaacttcttcgctgaaacagagcaagttgcattttgt
acacaaaacattgtacctggtatagattttaccaacgacccactactacaggggcgtaat
ttctcttatttagatactcagttgaaacgattaggtagtactaattttacgcacttgccc
attaacgcgcctaaatgccctatgcgtcacttccagcaagatggccatatggcaatgcat
aaccccaaaggtcgtgctaattacgagccaaactcttgggaagccgatgagaataatccg
cgcgcttgtccagaacatggattccagtcacataatgaagaggtttctggtgaaaaagtt
agacatcgctcagaaactttcgctgaccattacagccaagctcgtcaattttatatcagc
caaactgaaaccgagaaagagcatattcgcgacgcattcgcttttgagctatccaaagta
gagcgtttggcgattcgtgagagagtagtatcacatctattaaatgtagataaagacctt
gcgaaagccgtgggtgaagcgctgggcttctcagagatgccagagccagcagaggctgca
atggaaactagagaagacctcgttgagtctgatgcgttaagtatcttaaaaaatgcgccg
gatacgtttaaaggcagaaagctgggtattttagtgagtgatgaccttgacggtgaattg
cttgggaaagtaaaaactgctttagataatgaaggcgctatgtacgaggttgttgcgcct
caaattggcggcgttacttgtgataagggtaaaaaagtagatgcacagcagaaggtcgat
ggtgggccatcagtattatacgatgcggtgctgttactaatgtcgcagtcgggagccgaa
aagttagcgggcaagcctgaagcaaaagattttgtttctgatgcgtttgctcacaacaag
tttatcggctacacagatgccgcaatgccacttatcaaggccgttggcttagatagcatg
atagacgaaggttttgtggaccttaaacaaaagtcggcagacgaatttattaaaacacta
cgtggtattcgctattgggctagatcttaa

DBGET integrated database retrieval system