KEGG   Alteromonas macleodii Ionian Sea U7: I876_16260Help
Entry
I876_16260        CDS       T02721                                 

Definition
delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
amae  Alteromonas macleodii Ionian Sea U7
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:amae00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    I876_16260
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    I876_16260
Enzymes [BR:amae01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     I876_16260
Lipid biosynthesis proteins [BR:amae01004]
 Desaturase
  First
   I876_16260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3709316..3710443
Genome map
AA seq 375 aa AA seqDB search
MKKPPLILTNALVFIISGAIAFIGVPLWVAYQGIDWAEIGTAIFLFYFTGMSITAGYHRL
WSHKTYDANIVVRIILAIGGAMALQNSILHWSSDHRVHHRHVDDNDKDPYSAKKGLWFAH
IGWMLREYQAKRYDDYSNCKDLQKDSVVMWQHKYYLPIVLAANFGITGLLGYLNGDVMGM
ILVAGVLRLVLVHHVTFFINSLAHFWGSQPYTDKNTARDNGVLAFFTFGEGYHNYHHIFE
YDYRNGIRWYQFDPTKWLIKGLSYVGLTSNLRKVPEERIEKALAAMQLQRASEKVSVLPN
AEEMMHTIQEEYDLLMQRMSEYYATKKRVMRVKQRTLKRSIEGLELAYKYKELKHAFAVQ
KEKWTHLQSLSLQMA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacctcctcttatcctaactaatgcgctggtatttataatatctggcgcaata
gcatttattggtgtgccgctatgggtggcgtatcaaggcattgattgggcagaaattggt
actgctatatttctgttctactttaccggcatgtcgattactgctggttatcaccgtctg
tggtctcacaagacctacgatgcaaacattgttgtacgcatcattcttgctatcggcggc
gctatggccttgcagaatagtattttgcattggtcttctgatcaccgtgtgcatcaccgc
catgtagacgacaacgacaaagatccttactctgcaaagaaagggctttggttcgcgcac
atcggttggatgttacgcgagtatcaagctaagcgttacgatgactacagcaactgtaaa
gacctgcaaaaagatagcgtggtgatgtggcagcacaaatactacttacctatcgtactc
gctgctaactttggcattactggtctattaggctatttgaacggcgacgtgatgggcatg
attttagtagcgggcgttcttcggttggtgctagttcatcatgttacgttttttattaat
tctctggcccatttttggggtagtcagccttataccgataaaaatacggcgcgagataat
ggcgttttagctttcttcacgtttggcgagggttatcacaactaccaccatatctttgaa
tacgattaccgcaacggcattcgttggtatcagtttgatcctactaaatggctaatcaaa
gggctgtcttatgtaggtttaacgtcgaaccttcgcaaagtacctgaagagcgcatcgaa
aaggcactggcggccatgcagcttcaaagggctagtgagaaagtatcggtactgcccaac
gctgaagaaatgatgcacactattcaagaagagtacgacctgcttatgcagcgaatgagt
gaatactacgcgacgaaaaagcgcgtgatgcgtgttaagcaacgcaccttaaaacgcagt
attgaagggttagaacttgcgtataagtacaaagaactgaagcacgcgtttgctgtgcag
aaagaaaaatggacacatttgcaaagcttatcgttacaaatggcctag

DBGET integrated database retrieval system