KEGG   Alteromonas macleodii Aegean Sea MED64: I533_16890Help
Entry
I533_16890        CDS       T02958                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
amag  Alteromonas macleodii Aegean Sea MED64
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    I533_16890
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    I533_16890
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    I533_16890
Enzymes [BR:amag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     I533_16890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3859129..3860823
Genome map
AA seq 564 aa AA seqDB search
MDRRTFIRLSSFAGASVAVSTGLAGCTVSTSANSQPQTKSEFTHGVASGDPLKDAVIIWT
RAVPTSSSALVKADILWEMASDAAFTDVVSSGVVEAKATHDFTVKVDVSGLQPASKYFYR
FKSANNVSPVGETRTLPEADVSKITFGIFSCSNYPAGFFTPYMEAAKDDNMDYVLHLGDY
IYEYDGKGYATEHAKEIGRTYAPDNDTELYTLTDYRNRYALYRTDEGLLALHQNKPFIVV
WDDHEITNDTYKDGAENHQADEGDFYERRAAAVQAYYEWLPIRPPFGTERLEIYRQFTFG
NLLDLYMLDTRVLARDKQLEYANYRDAETKAFDQAGFMKDISNPNRGLLGETQRNWLHTS
MKQSQAKWQVLGQQLLIGRMLFPVSIFNGVERKDIPAHVHKLANIKRKQMQGNTLSEQEL
ALINTVMPYNLDAWDGYPVEREQVLMQLKSIGKPVIALAGDTHNAWHNKLTLKDGTEVGV
ELATPGVTSPGMEHYLSMDDEMAETLADDLPLLIDDLQYCNLHQRGFMTLTVSEDEAKAT
WHYVDAILTKAGKVVNTHSFEIKA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggatagaagaacgtttattaggctgtcgtcattcgcgggtgcgagcgtggcagtatct
actgggctagcggggtgtacagttagcacgtcagcaaacagtcagcctcaaactaaatcg
gaatttacccatggcgtggccagtggcgacccgttaaaagatgcagtgatcatttggact
cgcgcggttcctacatcaagctcggctttagttaaagccgatattttgtgggaaatggca
agcgatgcagcatttaccgacgtggtaagtagcggagtcgttgaggctaaagcgacacat
gactttaccgtaaaagtagatgtgtcaggtcttcagcctgcaagcaaatacttttatcgc
ttcaaaagtgcgaataatgtgagccctgttggcgaaactcgtacattgccggaagcagac
gtatctaagatcacattcggcatattttcttgctcgaactaccctgccggctttttcacg
ccttatatggaagccgccaaagatgacaacatggattatgtgctgcatttaggcgactac
atatatgagtacgatggaaagggttacgccaccgaacatgccaaagagattggccgaacc
tatgcgccagataacgataccgagctatatacgctaaccgactaccgaaaccgctacgcg
ttgtatcgcaccgacgaaggcttgctggctttacatcaaaataagccgtttatcgttgtg
tgggatgaccatgaaattactaacgacacctataaagacggtgctgaaaatcaccaagcg
gatgaaggcgatttttatgaacgtcgcgctgcggcagtgcaagcctattatgagtggctg
cctattcgcccgccatttggcactgagcgtttagaaatctaccgtcagtttacctttggc
aacctgcttgatttatacatgcttgatacccgcgttttagcccgggataagcagcttgaa
tacgccaactatcgcgacgctgaaactaaagcttttgaccaagcaggctttatgaaagat
atcagtaatcctaatcgcggtcttttaggtgaaacccagcgcaattggctacatacctct
atgaagcaaagccaggctaaatggcaagtgctggggcaacagctattaattggccgcatg
ctattccctgtgtctatttttaacggcgttgaacgtaaagatattcctgcacacgtacac
aagctggctaatattaagcgcaaacaaatgcaaggcaatacgctaagtgagcaagagctt
gcgcttatcaatacggtaatgccctacaacttagacgcatgggatggctaccctgttgaa
cgtgaacaggttctcatgcagctaaaatccatcggcaagccagttattgcccttgcaggc
gatactcataatgcttggcacaacaaactaacccttaaagacggaacggaagtgggtgtt
gaacttgccacccctggggtgacgtcacccggcatggaacattatttaagtatggatgat
gaaatggcagaaacacttgctgatgaccttccccttcttattgatgatttacagtattgt
aatcttcaccagcgcggctttatgacattgaccgttagcgaggatgaagctaaagcgacc
tggcactatgtggatgcaattttgaccaaggctggaaaggtggttaacacgcatagcttt
gagattaaggcatag

DBGET integrated database retrieval system