KEGG   Alteromonas macleodii Aegean Sea MED64: I533_17305Help
Entry
I533_17305        CDS       T02958                                 

Definition
glutamate decarboxylase
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
amag  Alteromonas macleodii Aegean Sea MED64
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:amag00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:amag00250]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:amag00410]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:amag00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3948691..3950325)
Genome map
AA seq 544 aa AA seqDB search
MGEAQVSLEHLFRVFTKPEHKDSKLAQIEQHLSDNILDFLSQHVVTKKTSLEEIEKDFSD
SKVPESPEFVSTHAESLLDKLVAHSVNTYSPTFIGHMTSALPYFHLPLSKLMVGLNQNLV
KIETSKAFTPLERQVLGMMHNLVYDQPQRFYDNHLHSAAHSLGAFCSGGTIANITALWVA
RNKLLGPQDGFCGVAKAGLAAAYRHLDINNLGVMCSKRGHYSLSKAVDVLGLGRDQLLTI
PAPRQTLDPAKALRIGKRYQEEGNKLLAIVGVGGTTETGHVDPLDELADVANELGCWFHV
DAAWGGATLFSSRYRDRLKGIERADSVTIDAHKQMYVPMGAGMALFKDPQNANAVRHHAQ
YILRAGSKDLGATTLEGSRNGMAMMVYSALHIFGRKGYELLIDRSIDKAKDFSHMIDKAG
DFELTTTPTLSLLTYRVCPEEVQEKLKHADANMRNAINEKVDALVVAVQKQQREAGKSFV
SRTRLEAPDYPSQCITVFRVVLANPLTSHNDLAAILAEQHLIAKETQAWAELMNFVRDSE
KVAS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgaagcgcaagttagtttagagcacctgtttagggtctttaccaaacctgaacac
aaagactcaaagctggctcaaattgagcagcatttatctgacaatatcttagattttctg
tcgcagcacgtggtgacaaagaagacatcgttagaagaaattgaaaaagacttctcagac
tcgaaagtacctgagtcgccagagtttgtgtctacgcatgctgaaagcttacttgataag
ctggttgcgcattctgtaaatacctattcaccgacttttattggtcatatgacctctgcg
ctaccttattttcatctgccgttatctaagttaatggtgggccttaatcagaacttggtg
aaaattgaaacatcgaaagccttcacgcctttagagcgtcaagtgctaggtatgatgcac
aacttagtgtacgaccaaccgcaacgcttttacgataatcatttacacagcgcggcgcac
tcattaggcgcattttgctcaggcggaaccatcgcgaacatcactgcactatgggtagcg
cgcaacaagctgcttggcccacaagacggtttctgtggtgtcgcgaaagcgggtctggca
gcggcataccgacatctcgatataaacaacttaggcgtgatgtgctctaagcgtggtcac
tactctctgtctaaagccgttgatgtactaggtttaggtcgtgatcagctactgacaatc
ccggcgccgcgacaaacccttgatccggcaaaagcccttcgtattggtaagcgttatcag
gaagagggtaacaaactccttgctatagtgggtgtgggcggtactaccgaaaccgggcac
gtagaccctcttgatgagttagcagacgttgctaacgagttaggctgctggttccatgtg
gatgccgcgtgggggggagcaacactgttttcttcacgctatcgcgataggttaaaaggc
attgagcgcgctgactcggtaacgatagatgcccacaagcaaatgtatgtgccaatgggg
gcaggcatggccctatttaaagacccacaaaatgctaatgcagtaaggcatcacgcacag
tatattttgcgcgctggttcgaaggatttgggggccaccacgttagaaggctctcgtaac
ggtatggcgatgatggtctattccgccctgcatattttcgggcggaaggggtacgagcta
cttatcgaccgcagtattgataaagcgaaagacttctcgcacatgatagacaaagcgggt
gactttgagttaaccaccaccccgacattatcactactgacttatcgggtgtgccctgaa
gaagtgcaagagaagcttaaacacgccgatgccaacatgcgcaatgcgattaatgagaaa
gtggacgcccttgttgtggctgttcaaaagcagcagcgtgaagcgggtaagtcgtttgtg
tcacgtacgcgcttagaagcgcctgattacccttcccaatgtattacggtatttcgtgtt
gtgttagcgaacccgttgaccagccataacgatttagcggctattttggctgaacagcat
cttattgcgaaagaaacacaggcgtgggcagagttgatgaacttcgtgcgcgattctgaa
aaggtggcgtcctag

DBGET integrated database retrieval system