KEGG   Alteromonas macleodii Aegean Sea MED64: I533_17305Help
Entry
I533_17305        CDS       T02958                                 

Definition
glutamate decarboxylase
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
amag  Alteromonas macleodii Aegean Sea MED64
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amag00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    I533_17305
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I533_17305
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    I533_17305
   00430 Taurine and hypotaurine metabolism
    I533_17305
Enzymes [BR:amag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     I533_17305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3948691..3950325)
Genome map
AA seq 544 aa AA seqDB search
MGEAQVSLEHLFRVFTKPEHKDSKLAQIEQHLSDNILDFLSQHVVTKKTSLEEIEKDFSD
SKVPESPEFVSTHAESLLDKLVAHSVNTYSPTFIGHMTSALPYFHLPLSKLMVGLNQNLV
KIETSKAFTPLERQVLGMMHNLVYDQPQRFYDNHLHSAAHSLGAFCSGGTIANITALWVA
RNKLLGPQDGFCGVAKAGLAAAYRHLDINNLGVMCSKRGHYSLSKAVDVLGLGRDQLLTI
PAPRQTLDPAKALRIGKRYQEEGNKLLAIVGVGGTTETGHVDPLDELADVANELGCWFHV
DAAWGGATLFSSRYRDRLKGIERADSVTIDAHKQMYVPMGAGMALFKDPQNANAVRHHAQ
YILRAGSKDLGATTLEGSRNGMAMMVYSALHIFGRKGYELLIDRSIDKAKDFSHMIDKAG
DFELTTTPTLSLLTYRVCPEEVQEKLKHADANMRNAINEKVDALVVAVQKQQREAGKSFV
SRTRLEAPDYPSQCITVFRVVLANPLTSHNDLAAILAEQHLIAKETQAWAELMNFVRDSE
KVAS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgaagcgcaagttagtttagagcacctgtttagggtctttaccaaacctgaacac
aaagactcaaagctggctcaaattgagcagcatttatctgacaatatcttagattttctg
tcgcagcacgtggtgacaaagaagacatcgttagaagaaattgaaaaagacttctcagac
tcgaaagtacctgagtcgccagagtttgtgtctacgcatgctgaaagcttacttgataag
ctggttgcgcattctgtaaatacctattcaccgacttttattggtcatatgacctctgcg
ctaccttattttcatctgccgttatctaagttaatggtgggccttaatcagaacttggtg
aaaattgaaacatcgaaagccttcacgcctttagagcgtcaagtgctaggtatgatgcac
aacttagtgtacgaccaaccgcaacgcttttacgataatcatttacacagcgcggcgcac
tcattaggcgcattttgctcaggcggaaccatcgcgaacatcactgcactatgggtagcg
cgcaacaagctgcttggcccacaagacggtttctgtggtgtcgcgaaagcgggtctggca
gcggcataccgacatctcgatataaacaacttaggcgtgatgtgctctaagcgtggtcac
tactctctgtctaaagccgttgatgtactaggtttaggtcgtgatcagctactgacaatc
ccggcgccgcgacaaacccttgatccggcaaaagcccttcgtattggtaagcgttatcag
gaagagggtaacaaactccttgctatagtgggtgtgggcggtactaccgaaaccgggcac
gtagaccctcttgatgagttagcagacgttgctaacgagttaggctgctggttccatgtg
gatgccgcgtgggggggagcaacactgttttcttcacgctatcgcgataggttaaaaggc
attgagcgcgctgactcggtaacgatagatgcccacaagcaaatgtatgtgccaatgggg
gcaggcatggccctatttaaagacccacaaaatgctaatgcagtaaggcatcacgcacag
tatattttgcgcgctggttcgaaggatttgggggccaccacgttagaaggctctcgtaac
ggtatggcgatgatggtctattccgccctgcatattttcgggcggaaggggtacgagcta
cttatcgaccgcagtattgataaagcgaaagacttctcgcacatgatagacaaagcgggt
gactttgagttaaccaccaccccgacattatcactactgacttatcgggtgtgccctgaa
gaagtgcaagagaagcttaaacacgccgatgccaacatgcgcaatgcgattaatgagaaa
gtggacgcccttgttgtggctgttcaaaagcagcagcgtgaagcgggtaagtcgtttgtg
tcacgtacgcgcttagaagcgcctgattacccttcccaatgtattacggtatttcgtgtt
gtgttagcgaacccgttgaccagccataacgatttagcggctattttggctgaacagcat
cttattgcgaaagaaacacaggcgtgggcagagttgatgaacttcgtgcgcgattctgaa
aaggtggcgtcctag

DBGET integrated database retrieval system