KEGG   Alteromonas mediterranea MED64: I533_17305Help
Entry
I533_17305        CDS       T02958                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
amag  Alteromonas mediterranea MED64
Pathway
amag00250  Alanine, aspartate and glutamate metabolism
amag00410  beta-Alanine metabolism
amag00430  Taurine and hypotaurine metabolism
amag00650  Butanoate metabolism
amag01100  Metabolic pathways
amag01110  Biosynthesis of secondary metabolites
amag01120  Microbial metabolism in diverse environments
amag02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:amag00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    I533_17305
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I533_17305
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    I533_17305
   00430 Taurine and hypotaurine metabolism
    I533_17305
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    I533_17305
Enzymes [BR:amag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     I533_17305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGP83412
Position
complement(3948691..3950325)
Genome map
AA seq 544 aa AA seqDB search
MGEAQVSLEHLFRVFTKPEHKDSKLAQIEQHLSDNILDFLSQHVVTKKTSLEEIEKDFSD
SKVPESPEFVSTHAESLLDKLVAHSVNTYSPTFIGHMTSALPYFHLPLSKLMVGLNQNLV
KIETSKAFTPLERQVLGMMHNLVYDQPQRFYDNHLHSAAHSLGAFCSGGTIANITALWVA
RNKLLGPQDGFCGVAKAGLAAAYRHLDINNLGVMCSKRGHYSLSKAVDVLGLGRDQLLTI
PAPRQTLDPAKALRIGKRYQEEGNKLLAIVGVGGTTETGHVDPLDELADVANELGCWFHV
DAAWGGATLFSSRYRDRLKGIERADSVTIDAHKQMYVPMGAGMALFKDPQNANAVRHHAQ
YILRAGSKDLGATTLEGSRNGMAMMVYSALHIFGRKGYELLIDRSIDKAKDFSHMIDKAG
DFELTTTPTLSLLTYRVCPEEVQEKLKHADANMRNAINEKVDALVVAVQKQQREAGKSFV
SRTRLEAPDYPSQCITVFRVVLANPLTSHNDLAAILAEQHLIAKETQAWAELMNFVRDSE
KVAS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgaagcgcaagttagtttagagcacctgtttagggtctttaccaaacctgaacac
aaagactcaaagctggctcaaattgagcagcatttatctgacaatatcttagattttctg
tcgcagcacgtggtgacaaagaagacatcgttagaagaaattgaaaaagacttctcagac
tcgaaagtacctgagtcgccagagtttgtgtctacgcatgctgaaagcttacttgataag
ctggttgcgcattctgtaaatacctattcaccgacttttattggtcatatgacctctgcg
ctaccttattttcatctgccgttatctaagttaatggtgggccttaatcagaacttggtg
aaaattgaaacatcgaaagccttcacgcctttagagcgtcaagtgctaggtatgatgcac
aacttagtgtacgaccaaccgcaacgcttttacgataatcatttacacagcgcggcgcac
tcattaggcgcattttgctcaggcggaaccatcgcgaacatcactgcactatgggtagcg
cgcaacaagctgcttggcccacaagacggtttctgtggtgtcgcgaaagcgggtctggca
gcggcataccgacatctcgatataaacaacttaggcgtgatgtgctctaagcgtggtcac
tactctctgtctaaagccgttgatgtactaggtttaggtcgtgatcagctactgacaatc
ccggcgccgcgacaaacccttgatccggcaaaagcccttcgtattggtaagcgttatcag
gaagagggtaacaaactccttgctatagtgggtgtgggcggtactaccgaaaccgggcac
gtagaccctcttgatgagttagcagacgttgctaacgagttaggctgctggttccatgtg
gatgccgcgtgggggggagcaacactgttttcttcacgctatcgcgataggttaaaaggc
attgagcgcgctgactcggtaacgatagatgcccacaagcaaatgtatgtgccaatgggg
gcaggcatggccctatttaaagacccacaaaatgctaatgcagtaaggcatcacgcacag
tatattttgcgcgctggttcgaaggatttgggggccaccacgttagaaggctctcgtaac
ggtatggcgatgatggtctattccgccctgcatattttcgggcggaaggggtacgagcta
cttatcgaccgcagtattgataaagcgaaagacttctcgcacatgatagacaaagcgggt
gactttgagttaaccaccaccccgacattatcactactgacttatcgggtgtgccctgaa
gaagtgcaagagaagcttaaacacgccgatgccaacatgcgcaatgcgattaatgagaaa
gtggacgcccttgttgtggctgttcaaaagcagcagcgtgaagcgggtaagtcgtttgtg
tcacgtacgcgcttagaagcgcctgattacccttcccaatgtattacggtatttcgtgtt
gtgttagcgaacccgttgaccagccataacgatttagcggctattttggctgaacagcat
cttattgcgaaagaaacacaggcgtgggcagagttgatgaacttcgtgcgcgattctgaa
aaggtggcgtcctag

DBGET integrated database retrieval system