KEGG   Alteromonas macleodii Ionian Sea UM7: I635_06040Help
Entry
I635_06040        CDS       T02724                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
amai  Alteromonas macleodii Ionian Sea UM7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1320366..1321058
Genome map
AA seq 230 aa AA seqDB search
MRKLSPFILALALSPFVQAEPVSEVSPVGKIDGMVSLPVTGMKAVESNNRIIFMSDSGRF
VIDGTLYDAWSKKPLTSLEEIREAGNTLDLSRLGLKMADLNPLTLGEGKKKVVVFVDPRC
PHCHELLKQALPLTKEYTFQILPVPVLGPDSERQVRQLGCARDKKAATDALLNGRIGNLE
QDDACNLEPMQRTLVTAQILGIQGVPFIVANDGRISRGRPYDLSAWLEGR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaactatctccatttattctggcgcttgcgctgtctccttttgttcaagctgaa
cctgtgtctgaagtgtcgcccgttggcaaaattgacggcatggtttctttacctgtcacg
ggtatgaaagcggtcgaaagcaataaccgtattatttttatgtcagacagtggccggttc
gtcattgatggcacgctctatgatgcctggtccaaaaagccgcttaccagccttgaagaa
attcgagaagcgggaaacacgctggacttaagtcgccttggcttaaaaatggctgatttg
aacccactgactttaggcgaaggcaaaaagaaagtggtggtctttgttgaccctcggtgc
ccacattgccatgagcttttgaaacaagccctgccgttaaccaaagaatacaccttccaa
attctccctgtgccagtgcttggtccagattcagagcgtcaggttcgccagcttggctgt
gcgcgtgacaagaaagcggccaccgatgcattgctgaatggccggattggtaacctagaa
caggatgatgcctgcaacttagaaccaatgcagcgtaccttggtgacggctcaaattctg
ggcattcaaggtgtgcctttcattgtcgccaatgatggtcgcatcagccgaggtcgtcct
tatgacctttctgcttggttggaggggcgttaa

DBGET integrated database retrieval system