KEGG   Alteromonas macleodii Ionian Sea UM7: I635_09855Help
Entry
I635_09855        CDS       T02724                                 

Definition
glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
amai  Alteromonas macleodii Ionian Sea UM7
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:amai00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:amai00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:amai00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2188177..2189520)
Genome map
AA seq 447 aa AA seqDB search
MAEQSNLDEITTFLNDKFSGETEYLQATHEVLQDIVPIYNANAHYKAFDIVRRLCLAERI
INFTVSWMNSEGNIEVNQGWRVQHNSAMGPYKGGLRFHPTVNLSVLKFLAFEQCFKNALT
GLPMGGGKGGSDFNPKGRSDRDIMLFCQAFMRELQRHIGANTDVPAGDINVGAREIGYLY
GEYRRLNNKFEGVLTGKGLEFGGSYVRTEATGFGLIYFLDAVCQYKKTDLKGKTVTVSGA
GNVALHAALKAVEKGAKVISLSNSRGLLHSESGLSDKNLRWAIENHASSENILYDMAEQN
MGAWVADKKPWHLKCDIALPCATQNELQEEDANALLNNGCKMVLEGANMPCTTDAQKQFF
DAKITYVPGKASNAGGVALSGLEMGQNAMFNQRDASALDEQLCSIMNSIHERCVIEGKRE
DGYVDYMKGANIAAFRRLADAMLAQGV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacaaagtaatttggatgaaataaccacgtttcttaacgataaattttctggc
gaaactgaataccttcaagccactcacgaagtacttcaagatattgttcctatatacaat
gccaatgcgcactacaaagcgtttgatattgttagacgcctctgccttgcggagcgaatt
attaactttactgtctcgtggatgaatagcgaaggtaacattgaagtaaatcagggatgg
cgtgtacaacacaactcagcgatggggccatataaaggcggtctacgctttcaccctacc
gtaaatttatccgtgcttaaattcctagcgtttgaacagtgctttaaaaatgcattgacc
gggctaccaatgggtggaggaaaaggcggctcagattttaaccctaaggggcgttcagat
cgtgacatcatgttgttttgccaagcatttatgcgtgagttgcaacgacatataggcgca
aataccgatgtacccgcaggcgacattaacgtgggggcaagagaaatcggttatttatat
ggtgaataccgcaggctaaataataagtttgaaggcgtactcaccggcaaaggcttagag
tttggtggtagctatgttcgaaccgaagcaacaggttttggcctcatctactttttagat
gcggtgtgccagtataaaaagaccgaccttaagggcaaaacagtgacagtatcgggagcc
ggaaatgtcgcccttcatgccgccttaaaagccgttgaaaaaggcgctaaggtaatttca
ctatctaacagccgagggcttttacatagtgagagcggattaagtgataaaaacctgagg
tgggcaattgaaaatcatgcttcaagtgaaaacatactctatgacatggctgaacaaaat
atgggggcgtgggtagcggataaaaaaccttggcaccttaaatgcgacatagcgctcccc
tgtgccacgcaaaacgaactgcaagaagaagatgccaacgcactgcttaacaacggatgt
aaaatggtattagaaggtgccaatatgccttgcactaccgacgcgcaaaaacagtttttt
gacgccaaaataacctacgtaccgggcaaggcatctaatgctgggggcgttgcactttca
ggcttagaaatgggtcaaaatgctatgttcaatcagcgtgacgccagcgcgttagacgaa
cagctttgctcgattatgaacagtattcacgaacgctgtgtaatcgaaggtaagcgtgaa
gatggctatgtcgattatatgaagggggcgaatattgcggctttcaggcggctcgccgat
gccatgctagcgcaaggtgtttaa

DBGET integrated database retrieval system