KEGG   Alteromonas macleodii Ionian Sea UM7: I635_09910Help
Entry
I635_09910        CDS       T02724                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
amai  Alteromonas macleodii Ionian Sea UM7
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:amai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    I635_09910
  Amino acid metabolism
   00330 Arginine and proline metabolism
    I635_09910
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    I635_09910
Enzymes [BR:amai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     I635_09910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2199107..2200216
Genome map
AA seq 369 aa AA seqDB search
MSHPNWKRVVIKVGSALISPNQQGCSSHYLLSIAQFIVRCRANGTQVVLVSSGSVAAGAH
LFPEQEKSDIAVKKAMAAAGQTEMIATWDRLFDFPSAQMLLTHADLRDRERYVSIRETIF
SLLDNNILPIVNENDTVTTDKLKVGDNDNLSAMVASAAEADALIICSDIDGLYDKNPHEH
DDAKMLKSVDTIDQSIYDMAGGAVKGGVGTGGMRTKIEAAEKAVSHGIDTYIINGFTELS
FNMLLSGENPGTHFKPHAKPMQENVHWMRHTSNAQGEVIVEGDFDDSLHSDAEQLTSSEI
IDVKGEFSVGDTILVRKEDGTKLVKAKSNYSSCLLNFIANQENDEFAHEFEEKTGPIISD
QHIANLEKE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatcctaattggaaacgcgtagtcatcaaagtaggtagtgcattaatatcgccc
aaccagcaaggttgtagcagtcactatttgctgagtattgcacagtttatcgtgcgatgc
agagccaacggcacacaggtagtattggtgtcttctggctcagtcgcagctggcgcgcat
ttgtttccagagcaagaaaaatctgatattgcggttaaaaaagcaatggcagcagcaggc
caaaccgaaatgattgccacatgggacagactgtttgacttcccttcggcacagatgctt
ctaactcacgccgacttgcgcgacagagagcggtacgtgagtattcgtgaaacgatattt
agcttattggataacaatattctacctatcgtgaacgagaacgacacggtcactaccgat
aaattgaaagtaggtgacaacgataacttgtcagccatggtagcgtcggcagctgaagca
gacgcactgattatctgttcagacatcgatgggttgtacgataagaacccccacgaacat
gacgacgcaaaaatgctcaagtcggttgataccatcgaccaaagcatttatgacatggct
ggtggtgcggttaaaggcggtgtaggcaccggcggcatgcgcacaaaaattgaagcggcg
gaaaaagccgtttcgcatggtatagatacatatattattaacggctttactgagctgtcg
tttaacatgctgttgtcgggtgaaaacccgggtacgcatttcaaacctcacgccaagcca
atgcaagaaaatgtgcattggatgcgccatacttcaaacgcgcagggcgaggttatagta
gagggagatttcgatgactctctacacagcgacgcagagcagcttaccagcagcgaaatt
attgacgtgaaaggtgagttctcggtcggcgacaccatattagtacgtaaagaagacggt
actaagctggtgaaagcgaaatcgaattacagtagctgtttattgaatttcattgcgaat
caggaaaacgacgaatttgcccacgagtttgaagaaaaaacggggccaattatttctgat
cagcacatagcaaatctggagaaagaatga

DBGET integrated database retrieval system