KEGG   Alteromonas macleodii Ionian Sea UM7: I635_12110Help
Entry
I635_12110        CDS       T02724                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
amai  Alteromonas macleodii Ionian Sea UM7
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:amai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    I635_12110
Enzymes [BR:amai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     I635_12110
Exosome [BR:amai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I635_12110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2699614..2701806)
Genome map
AA seq 730 aa AA seqDB search
MHLAQQFEQVTCSQPFSHLGVIASQQGAMLRVWCPDASEVTIKWENSALADRVIKSDNAN
GLFEASLPAEYNGEIYRVVANKGRGDNGYIDPYQFTEQAYHAVHYIDSTPANLYEQAGAQ
LIDISTPQGKTVSGVRFCVFAPNASAVSLIGDFNQWDGRTHPMEKTSMGYWVLFVPELTE
GERYKYHIKDANGHDLPHKADPLGFCAEQYPSHASKIYNHRSYQWSDSDWMENRKGDKYA
SPMSIYEVHLGSWKRPDAATEARYLTYKELADDLIGYVSDMGYTHVELLPISEFPFDGSW
GYQPVGMFAPTSRFGNPDDFKYFVDKCHQAGVGVIIDWVPAHFPEDGHGLARFDGSCVYE
YEDPRKGWHPDWNSCIYDFGKDTVRQFLVANALYWLDKFHVDGLRVDAVASMLYLDYSRN
EGEWIPNVDGGNENYEAISLLKWMNEEVYKHFPDAMTIAEESTSFPKVSRPVFDGGLGFG
FKWNMGWMHDSLHYIAKDPAYRNYHHGDITFSMVYAFDENFVLPISHDEVVHGKGSMLHK
MPGDEWQQAANLRCYAGFMYGHPGKKLNFMGNELAQAREWNHDSSLDWHLLDFEKHAGIQ
ALYKALNHLYTSIPALYEQDHDPAGFAWLDHSNADQSVVSFVRTSKDAKQKVYVVSNFTP
VPRKNFRIGVDEACTLTLALNTDDGAYWGSNYEVVANTTAQLVPWNDRTHSVEITLPPLA
TVFYVADLSE
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgcatttagcgcagcagttcgaacaagtaacatgttcccaaccattttctcatcttggc
gtcattgccagtcaacaaggtgcaatgcttcgtgtttggtgtcctgacgccagcgaagta
acgattaaatgggagaattctgcgctagctgatcgagttattaaatcggacaatgcgaat
ggcttatttgaagcgtcacttcccgctgagtacaacggtgaaatttaccgcgtagtcgct
aataaggggagaggggataatggttatatcgacccttatcaatttactgaacaggcttac
catgccgtacattatatcgatagcacgccagcaaatttgtacgaacaagcgggtgcgcag
ttaattgatatctctacaccacagggcaagacggtaagtggcgtgaggttttgtgtattt
gcgccaaatgcaagcgcggtatcactcattggcgatttcaaccagtgggacggacgtact
cacccgatggagaaaacgtcgatggggtattgggtgctcttcgtacccgagctcactgaa
ggcgaacgctataaatatcatatcaaagacgccaatggtcatgatttaccgcataaagct
gaccccttaggattctgtgctgagcagtatccttctcatgcgtcgaaaatttataatcac
cgttcctaccagtggagcgatagtgattggatggaaaatcgcaagggggataaatacgcc
agccctatgagcatttatgaggttcacttaggctcatggaaacgacctgacgctgctaca
gaggcgcggtatcttacctataaagaacttgccgatgatttgattggttacgttagcgat
atgggctacacccatgtggaactgctaccaatatcagagtttcctttcgacggctcgtgg
ggataccaaccggtaggtatgttcgcgcctaccagtcggtttggcaatccagatgacttc
aaatactttgtcgataaatgtcaccaagccggcgtgggcgttatcatcgattgggtacct
gctcattttcctgaagatggacacggtctggcaaggtttgacggttcgtgtgtgtatgaa
tatgaagaccctcgtaaaggctggcacccagattggaactcatgtatctatgactttggc
aaagataccgttcgtcaatttttagttgccaatgctctttactggcttgacaagtttcac
gtggacggacttcgggttgatgcggtagcgtctatgctttatttagattactcccgcaac
gaaggcgagtggatcccgaacgttgacggcggtaatgaaaattacgaagcgataagcctg
cttaaatggatgaacgaggaagtatacaagcacttcccagacgctatgactatagcggaa
gagtccacgtcatttcccaaagtatctcgccctgttttcgacggtggcttaggctttggc
tttaaatggaacatgggctggatgcacgactcgctgcactacattgcaaaagaccctgca
tatcggaattaccaccacggtgatattacgtttagcatggtttatgcctttgatgaaaat
tttgttttacccatttcccatgatgaagtcgtacatggtaaaggcagcatgttacacaag
atgccgggcgatgagtggcaacaagccgctaatttgcgctgttacgcaggtttcatgtat
ggccatccaggcaagaagcttaacttcatgggtaacgaactggcgcaagcacgggaatgg
aatcacgatagcagcttagactggcacttgcttgacttcgaaaagcacgcaggtattcaa
gcgctgtataaggcgttaaaccatttgtacacctcaatcccagccctttatgaacaagac
catgacccggcgggttttgcgtggcttgatcacagcaatgcggatcaaagcgttgtgtcg
tttgttcgcacttcaaaagatgcaaagcaaaaagtctacgtggtgtctaactttacacct
gttccgcgcaagaactttagaattggtgtggatgaagcctgcacgttgacgctggcgctg
aacaccgacgatggggcttattggggtagcaactacgaagtcgttgccaacacaaccgca
caacttgttccgtggaatgatcgtacacattcagtagagataaccttaccgccacttgct
acggtgttttacgttgctgatttgagtgaatga

DBGET integrated database retrieval system