KEGG   Alteromonas macleodii Ionian Sea UM7: I635_17110Help
Entry
I635_17110        CDS       T02724                                 

Definition
endoglucanase Y
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
amai  Alteromonas macleodii Ionian Sea UM7
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amai00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3855131..3856231)
Genome map
AA seq 366 aa AA seqDB search
MVTGFKATKTLLAIALTLLLVSCSTKEDNAFKSQFMAYKALFIDGGRVVDTGNDEVSHSE
GQGYGMLFAVAADDKDTFDALWHWTQRTLLRSDGLFSWRYRPCADNSESCIDDPNNASDG
EILIAWALLRASEKWGIKGYQDEAGKIVQAVEQKLLVEHQGGVMLLPGEYGFTSQSEGQK
SLQLNLSYWVFPALTDLSALSNTPSRWQKLHQTGLTLLSNMQFSSYQLPSDWVRFEPRNS
GSAKSGLSGELTLTNVVSAEFGFNAIRIPLQLAWSEQVRDNAALAEELFAPYYQWWAKTP
TPATVNLLTEQTAEYEMTPGMQSVKLAVKYLMKSEEPVWPTVNRKMDYYSASLTLLSMLA
VSDNAS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccggatttaaggcaacaaaaacgctgctggcgatagcactaaccctattgtta
gtgtcgtgctccacaaaagaagacaatgcttttaaatcgcaatttatggcgtataaagcg
ctatttatcgacggcgggcgtgtggtagatacgggaaacgatgaggtgtcgcacagcgaa
gggcaaggttacggcatgttattcgctgtagcagccgacgacaaagataccttcgatgcc
ctatggcactggacccagcgcacgcttttgcgcagcgatgggcttttcagctggcggtat
cgcccatgtgccgataattcggagtcgtgtatagacgacccgaataatgcatcagatggc
gagattttaattgcatgggccttgttacgggccagtgaaaaatggggaataaagggatat
caagacgaagcgggtaagattgttcaggctgtagagcaaaagctgttggtagagcatcaa
ggtggcgtgatgttactacctggtgagtacggcttcacctcacaaagcgaggggcaaaag
agcctccagcttaatctgtcatactgggtttttcccgcacttacagatttatctgcctta
tccaatacaccgtcgcgatggcaaaagctccatcaaactgggcttactttgctttcgaac
atgcaattttcatcctatcaactgccaagcgactgggtgcgttttgaaccccgcaatagt
ggttcagcaaagtcagggttatccggtgagctcaccctaaccaacgtggtatctgcagag
tttggctttaacgctattcgcattccgctgcagttggcatggtccgaacaggttcgagac
aacgcggcattagccgaagaactttttgcgccctattatcaatggtgggctaaaacgcct
actccagccactgttaatctacttaccgagcaaaccgctgaatatgagatgacacccggc
atgcagtcggtgaagttagccgtcaagtaccttatgaaatctgaagaaccagtgtggcca
acagttaatcgcaagatggactattactcggccagtttaacgctgctctctatgctagcg
gtgtcggataacgcatcgtga

DBGET integrated database retrieval system