KEGG   Alteromonas macleodii Ionian Sea UM7: I635_20020Help
Entry
I635_20020        CDS       T02724                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
amai  Alteromonas macleodii Ionian Sea UM7
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:amai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    I635_20020
  Amino acid metabolism
   00330 Arginine and proline metabolism
    I635_20020
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    I635_20020
Enzymes [BR:amai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     I635_20020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4523920..4525017)
Genome map
AA seq 365 aa AA seqDB search
MNRFTWQRAVIKVGSALIAPEGNECSGRYLLSLARFITASREAGKEVILVSSGSVAAGRS
KVKVRHNASIAEKQAMAAIGQNLMMANWQRFFDFPCAQVLLTADDLRDRTRYVNIKNTLR
EILKHNALPIVNENDTVAANELKVGDNDNLGAYTALVAQADTLIICSDIDGLFTADPRKD
NTATLIPHVGKIDSTIYGLAGGAGTAVGTGGMRTKIEAADKCTSSGIQTLIVNGRKGETF
DALLEGEVPGTLFEASSTPTNARRLWLTHTLKTAGRIEVDSGAKEALIQKGASLLPSGII
DVVGQFEQGDAVEVICQGAVVAKGLCLYNAKDLGLIKGKKSKDIASVLGYETTDVAVHRD
DMVLY
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttttacttggcaacgtgccgttattaaagttggcagtgccctcattgcgcca
gagggaaatgaatgcagtggtcgctacttactttctttagcgcgttttattaccgcaagc
cgagaggcgggcaaagaagttattctggtctcttctggtagtgtggccgctgggcgcagc
aaagtgaaggtaaggcacaatgcttctattgccgagaagcaggcgatggcagcaatcggt
caaaaccttatgatggctaactggcagcgctttttcgactttccttgtgcgcaagtgtta
cttacagcggatgacttgcgggatagaacccgttacgtcaacatcaaaaacaccttgcga
gaaattttaaagcataacgccctgcctatcgtgaatgaaaacgatacggtggccgctaac
gagctaaaggttggagataacgacaatttaggcgcctacaccgcattggtagcccaagcc
gacaccttaattatttgctctgatattgatggtttgtttaccgctgaccctcgaaaagac
aacaccgcaacgcttattcctcatgttgggaaaattgatagcaccatttatggactggct
ggtggtgctggtactgcggtcggcacgggtggtatgcgcacgaaaatagaagccgcagac
aaatgtaccagtagcggtattcaaacgcttatcgttaacggtagaaaaggcgaaaccttt
gatgcactgcttgaaggcgaagtgccgggtacgctgtttgaagcaagcagcacaccgacc
aatgcacgcaggctgtggcttactcacacccttaaaaccgctggcagaatagaagtagat
agcggcgctaaagaagcattgatacaaaaaggtgcatctttgttaccttcaggaataatc
gacgtcgtcggccaatttgagcaaggtgatgcggttgaagttatctgccaaggtgccgtt
gtcgctaagggactttgtttgtataacgcaaaagacttgggcctcataaaagggaaaaag
tcgaaagacattgccagtgtgttaggttatgagacaaccgatgtcgctgttcatcgcgac
gacatggtgctgtattaa

DBGET integrated database retrieval system