KEGG   Alteromonas macleodii Ionian Sea U4: I607_03610Help
Entry
I607_03610        CDS       T02720                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
amal  Alteromonas macleodii Ionian Sea U4
Brite
Enzymes [BR:amal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     I607_03610
Secretion system [BR:amal02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   I607_03610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
813569..814291
Genome map
AA seq 240 aa AA seqDB search
MKAVQKMLLAGAFAVGSLLSISTQAADEAAIRDKLTSMLGLDVETIADSPVSGLVQVSTN
RGLFYVSENGQYLLQARVFNIDEEMRNETELALSGLRKDGVKQMKSSSITFKAENEKYEI
SVFTDITCGYCRKFHNEIDELNDAGITVHYLAFPRSGLNSQNYDDMVSVWCAKDPQKALT
KAKAGSDVASASCKNKVAEQYMLGQKLGVNGTPNIVLPDGSLIPGYQPAKMLAKALAATE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcagtacagaaaatgttgttagccggcgcctttgccgtaggttctttgttgagc
ataagtacacaggctgcagatgaagccgccattcgcgacaagctaacctcaatgttaggg
ttagacgtggaaacgattgctgattcacccgtttcaggcttggtacaagtctctactaac
cgcgggttattttatgtgagcgaaaacgggcaatacttgcttcaagcgcgggtttttaac
attgatgaagaaatgcgtaacgaaacagagcttgccctatcaggattgcgtaaagacggc
gtaaaacaaatgaagtcgtcgtcaattacgtttaaagcggaaaacgagaagtacgaaatt
agcgtgttcaccgatattacctgcggttattgccgtaaatttcataacgaaattgatgag
ttgaacgatgcgggcattaccgttcattatcttgcctttccccgttctggtttaaacagc
cagaattacgacgatatggtatcggtatggtgtgctaaagatcctcaaaaagcgctgact
aaagcgaaagcgggaagcgatgttgcaagcgcaagttgtaaaaacaaggtcgctgaacaa
tatatgctggggcaaaaattaggggtgaacggcacgccaaatattgtgttacctgatggt
tcacttattccagggtatcaacctgctaaaatgttagcgaaggcattagcagcgacagag
taa

DBGET integrated database retrieval system