KEGG   Alteromonas macleodii Ionian Sea U4: I607_07770Help
Entry
I607_07770        CDS       T02720                                 

Definition
Kynureninase
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
amal  Alteromonas macleodii Ionian Sea U4
Pathway
Tryptophan metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:amal00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1728257..1729492
Genome map
AA seq 411 aa AA seqDB search
MINKVFSSEQLDDKDPLAHKAGAFSLPDNTIYLDGNSLGPLTKSAEKRAVEVVQEQWGQG
LITSWNKHQWISLPQQVGDKIGELIGAQQGQVICCDSISINLFKVLSAALKMNPRRKVIA
TTRDNFPTDIYMVQGLLDLLGEEYSIRYVDEASISSQLTDDIAVLMLTQVNFRSGLKLDM
KGITEQAHAKGILTLWDLAHSAGAFPVCLDDCNVDFAVGCSYKYLNGGPGAPAFIYVARR
HQDSYQQPLSGWMGHSAPFSFSPDYAPDSSVKQNLCGTPGVIGMSILDAALDVFDDVSLK
AIDEKSKKLQAFFIAEAKRAGVLEHFGVASPPINCRGSQLALAHDEAYAICQAWIAEGVI
ADFRAPNILRIGFAPLYLSFADVEKAVTRLAIIMNEKRYENATFQQRQSVT
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaggttttttcctctgagcaacttgatgacaaggacccgcttgcacataaa
gctggggctttttcgcttccagacaacaccatctatttagacggtaattctcttggccct
ttaacgaaatcagcagaaaagcgagcggttgaagtagttcaagagcaatgggggcaaggc
cttattacaagttggaacaaacaccagtggatttccttacctcaacaagtcggcgacaaa
ataggggagcttataggcgcgcaacagggccaggtcatctgttgtgactctatctctatt
aacttatttaaagtgttaagcgccgcgcttaaaatgaacccaaggcgcaaagtaattgcg
accacacgtgataattttccaaccgatatctatatggttcaagggttgttagatttactt
ggcgaagagtacagtatccgctatgtagatgaagccagtattagtagccagttaactgat
gatattgccgtgcttatgcttacgcaggttaactttcgaagtgggcttaagcttgatatg
aaaggcattaccgagcaagcacatgcaaaagggattttgacgttgtgggatcttgcccat
agtgccggtgctttcccagtatgcttggatgattgcaacgtagattttgccgtagggtgt
tcgtacaagtatttaaacggcggccccggcgcgccagcatttatttatgttgcgcgccgt
catcaagatagctatcagcagcccctgtctggatggatgggacacagtgcccctttttca
ttttctcccgactacgcgccagatagctcggtaaagcaaaacttgtgcggtacgcccggt
gttataggcatgagtatattagatgcggcattagacgtttttgacgatgtgtcactgaaa
gccatcgacgagaagtcgaaaaagcttcaagctttttttattgctgaagcaaaaagggca
ggggtgttagaacatttcggtgtggcgagcccaccgattaattgccggggtagccagtta
gccctcgcccacgatgaggcttatgccatttgccaagcgtggattgctgaaggggtgatc
gctgacttccgcgcacctaatattttgcggatagggtttgcgccgctttatttgagcttc
gccgatgtcgaaaaggcggtaacaaggcttgcaataatcatgaacgaaaaacgttatgaa
aatgcgacattccagcaaagacagagcgttacctga

DBGET integrated database retrieval system