KEGG   Alteromonas macleodii Ionian Sea U4: I607_08785Help
Entry
I607_08785        CDS       T02720                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
amal  Alteromonas macleodii Ionian Sea U4
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amal01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:amal00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1965581..1966690
Genome map
AA seq 369 aa AA seqDB search
MSHPNWKRVVIKVGSALISPNQQGCSSHYLLSIAQFIVRCRANGTQVVLVSSGSVAAGAH
LFPEQEKSDIAVKKAMAAAGQTEMIATWDRLFDFPSAQMLLTHADLRDRERYVSIRETIF
SLLDNNILPIVNENDTVTTDKLKVGDNDNLSAMVASAAEADALIICSDIDGLYDKNPHEH
DDAKMLKSVDTIDQSIYDMAGGAVKGGVGTGGMRTKIEAAEKAVSHGIDTYIINGFTELS
FNMLLSGENPGTHFKPHAKPMQENVHWMRHTSNAQGEVIVEGDFDDSLHSDAEQLTSSEI
IDVKGEFSVGDTILVRKEDGTKLVKAKSNYSSCLLNFIANQENDEFAHEFEEKTGPIISD
QHIANLEKE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatcctaattggaaacgcgtagtcatcaaagtaggtagtgcattaatatcgccc
aaccagcaaggttgtagcagtcactatttgctaagtattgcacagtttatcgttcgatgc
agagccaacggcacacaggtagttttggtgtcttctggctcagtcgcagctggcgcacat
ttgtttccagagcaagaaaaatctgatattgcggttaaaaaggcaatggcagcagcaggc
caaaccgaaatgattgccacatgggacagactgtttgacttcccttcggcacagatgctt
ctaactcacgccgacttgcgcgacagagagcggtacgtgagtattcgtgaaacgatattt
agtttattggataacaatatcctacctatcgtgaacgagaacgacacggtcactaccgat
aaattgaaagtaggtgacaacgataacttgtcagccatggtagcgtcggcagctgaagca
gacgcactgattatctgttcagacatcgatgggttgtacgataagaacccccacgaacat
gacgacgcaaaaatgctcaagtcggttgataccatcgaccaaagcatttatgacatggct
ggtggtgcggttaaaggcggtgtaggcaccggcggcatgcgcacaaaaattgaagcggcg
gaaaaagccgtttcgcatggtatagatacatatattattaacggctttactgagctgtcg
tttaacatgctgttgtcgggtgaaaacccgggtacgcatttcaaacctcacgccaagcca
atgcaagaaaatgtgcattggatgcgccatacgtcaaacgcgcagggcgaggttatagta
gagggagatttcgatgactctctacacagcgacgcagagcagcttaccagcagcgaaatt
attgacgtgaaaggtgagttctcggtcggcgacaccatattagtacgtaaagaagacggt
actaagctggtgaaagcgaaatcgaattacagtagctgtttattgaatttcattgcgaat
caggaaaacgacgaatttgcccacgagtttgaagaaaaaacggggccaattatttctgat
cagcacatagcaaatctggagaaagaatga

DBGET integrated database retrieval system