KEGG   Alteromonas macleodii Ionian Sea U4: I607_11455Help
Entry
I607_11455        CDS       T02720                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
amal  Alteromonas macleodii Ionian Sea U4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amal00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2551526..2553724)
Genome map
AA seq 732 aa AA seqDB search
MTQQLLQQLVEMRGIETQYVDAWGKPATIAESSKAKLLNTLGYDTSSDEKIQSQITQDIK
SVWLSPLNPVQVVRNTQEINLAVRLPIELVNDVHTLTVTCEAGNVLTHDFTPVDQEMTTM
AHIDDVEFHEYVVTLPLDLPLGYHDVALSADDDEFARSRIIVAPEACYTPNEIKEGKKIW
GLSVQLYCVRSENNWGIGDFSDLSQLIEKAAGVGADFIGLNPIHALYPANPNACSPYGPS
SRRWLNYLYIDVTSIEGYDDTSVQTIVNDDEFTATLEHARNVKHVDYEAVAHIKLAALKA
VFGVYEAKYLRKNTKQNKAFKAFVEAGGESLDMLAVYDALQSHLKGEGKESWGWPVFPEE
FKDYHNPAVAKFKRANEHEVKFYLFLQWIAAQQLEQASNKASDAGMTIGLYRDLAVGVSE
GSAEIWGNKDLYCTDASVGAPPDILGPLGQNWGLPPMDPRKLYEQGYQPIIDLFASNMAS
SGSLRIDHVMALLRLWWVVKGDDAKEGGYVYYPVDDLLGILALESHRNQSLVIGEDLGTV
PEEIRSKLAENGVYSYRVFFFEQAEDGGFFSPSHYPVQSMSTLTTHDMPTLIGYWHCLDL
ELGKEIGLYPTEEILLTLYTDRHKNKQAILDTLHGHGSISDSISHDVNFTGMNRELNNGM
QVHMAGGSSALLSLQLEDWLEMDKPVNIPGTFDEYPNWRRKLTENIESMFERHDINELAS
KLSHARKQASQG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaacttctgcaacaactggttgaaatgcggggaatagaaacccaatacgta
gacgcatggggaaaaccagcaaccatcgcagaatcaagcaaagcgaaattgctcaataca
cttggctatgacaccagcagtgacgaaaaaattcagtcacaaattacacaagatataaag
tcggtgtggttgtcgccactaaatcctgttcaggtggttcgcaacactcaagagatcaat
ctagccgtgcgcttacctattgagttggtaaacgatgtacacaccctaactgttacctgt
gaagcgggtaacgtacttactcatgacttcacgccggttgaccaagaaatgacaaccatg
gcgcatattgatgatgttgaatttcatgaatacgttgtaacgctacctttagatttgccg
ttgggatatcacgatgtcgcactaagtgccgatgacgatgaatttgcgcgttctcgcatt
attgttgcaccagaagcctgctacacgccgaatgaaattaaagaaggcaagaaaatatgg
ggcctaagcgtacagttatattgtgtgcgtagtgaaaataactggggtatcggtgacttc
tcggacctttctcaacttattgaaaaagcagcgggcgttggagcagactttattggctta
aatcctattcacgccttatacccagcgaacccaaatgcatgctctccttatggtccaagt
tctcgccgctggttaaattacctgtacatcgacgttacgtcgattgaaggctacgacgac
acatcagtgcaaacaatagtgaacgatgacgagtttaccgctactttagagcatgcgcgc
aatgtaaagcatgtggactacgaagccgtagcacatattaagttagccgcgcttaaggct
gtatttggagtgtatgaagccaaataccttcgtaagaacacaaagcaaaacaaagcattc
aaagcgtttgttgaagcaggcggtgaaagtttagatatgcttgcggtgtatgatgcgctg
caatctcaccttaagggtgaggggaaagaaagttgggggtggcctgtattcccagaagag
tttaaagattatcacaatccagccgtcgctaaatttaagcgcgccaacgaacacgaagtg
aaattttacttgttcttacaatggattgctgcgcaacagctagagcaggcgagcaacaaa
gccagtgatgctggcatgaccattggcttgtatcgcgacctagcggtaggtgttagcgag
ggaagcgcggagatttggggcaataaagacctttactgtactgatgccagtgtaggcgcg
ccaccagatattttaggcccccttggtcaaaactggggtcttccaccaatggacccgcgc
aaattatatgaacaaggctatcagcccattatcgacttatttgcttctaacatggcgtca
tcaggttcgctacgaatcgaccacgtaatggcgcttctgcgattatggtgggtcgttaag
ggtgacgatgcaaaagaaggcggttatgtttactatccggtagatgatttgttaggcatt
cttgcgctagaaagtcatcgtaaccaaagccttgtaattggcgaggacctaggcacagta
cctgaagagattcgcagtaagcttgctgaaaatggcgtgtattcgtatcgcgttttcttc
tttgagcaagccgaagacggcggtttcttctcgccaagtcactatccggttcagtcgatg
tcgacgttaaccactcacgatatgcccacacttatcgggtactggcattgtttagattta
gaattaggcaaagagattgggctgtatccaacagaagaaatcctgctaaccttgtataca
gaccgtcacaaaaataagcaggctattctagataccttgcacgggcatggttcaattagc
gatagtatcagtcacgatgttaattttacgggtatgaaccgtgaattaaacaacggaatg
caggtacacatggcagggggctctagtgctctgctcagtcttcaattagaagactggctg
gaaatggacaagccagttaatatccctggtacttttgacgaatatcctaactggcgtaga
aagctgacagagaatatcgagtcgatgttcgaaagacatgatataaacgaattagcatct
aaactttctcatgcaagaaagcaagccagccaaggttaa

DBGET integrated database retrieval system