KEGG   Alteromonas macleodii Ionian Sea U4: I607_11660Help
Entry
I607_11660        CDS       T02720                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
amal  Alteromonas macleodii Ionian Sea U4
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:amal00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amal00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2597632..2598834
Genome map
AA seq 400 aa AA seqDB search
MNIIKARNDVYKAFALMAGILFTGCCLAMPAGTDIVVVKSRTNEAVDTSENASPHQFQTV
NQAVAYVESQAQQQGKIWTIFVKEGTYRERVVIALDNLRIVGESRDATTIVFSRYAGQKV
SDGSEEKWGTRRTATVEIVGNNVTIENITITNDFDYPGNEVKAKDDPTRLSGTQAVALKT
DVNSDRTYLNNVALWGYQDTLYLKGDRALIEGGIIAGHIDFIFGEGTAFFDGVTILSRAR
FSDGDAEGLTGYITAPSTHLQRPYGFTFHNCKLEREDGVPDMSVALGRPWHPTTSFSDGR
YANPYAVGKATFINTYMSGHITQARWTTMGGTIPSGEKRPFSPHTEARFSEYQSHGEGAH
DRATTPAMESHFLDANAAAFYTKEAVLRGWKPDTTMYNIK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaacattatcaaagcgcgtaacgatgtttataaagcctttgcgctaatggcgggtatt
ctattcactggttgttgtctagcaatgcctgctggtacagatattgtagttgtgaaatca
cgtaccaatgaagctgttgatacgtcagaaaatgcatccccccatcagtttcaaacggtt
aaccaggctgtggcgtatgttgaatctcaagcacaacagcagggcaaaatttggactatt
ttcgtaaaagaaggcacctaccgagaacgggttgtgatcgccttagataatcttcgtatc
gttggtgaatcgcgagatgcaacaactatcgtatttagccgatacgcagggcaaaaggtc
tcagacggttctgaagaaaaatggggaacccgtcgcaccgccacggtggaaatagtagga
aataatgtcaccatagaaaacatcactatcaccaacgattttgattatcccggtaacgag
gttaaagcaaaagatgacccgactcgcctctcaggtacacaagcggtagcacttaaaaca
gacgttaattcagatcgcacttatcttaacaacgtcgcgctatggggttaccaagacacc
ctttatttgaaaggtgaccgcgctctgatagaaggcggaataatagcaggacatatagat
tttatttttggggaaggcacagcattttttgatggcgtcacaattctttcaagagctcgt
ttttccgacggcgatgccgaaggactcactggttacattactgcaccaagtacgcactta
cagcggccatatggattcacattccataactgcaagctagaaagagaagatggtgtgcca
gatatgagcgttgcactaggaagaccttggcatccaacgaccagcttttctgacggccgc
tatgccaatccttatgcggtaggcaaagccacatttataaacacctacatgtcaggacat
attacgcaagctcgttggactaccatgggcggcactatcccatcgggagaaaaaaggcca
tttagtcctcacaccgaagccaggttttctgaataccaatctcatggtgaaggtgcccac
gacagagctactacacctgcaatggagtctcattttctagacgccaacgctgcagctttt
tacaccaaagaggcggtattgcgaggctggaagccggataccacaatgtacaatattaaa
tag

DBGET integrated database retrieval system