KEGG   Alteromonas macleodii Ionian Sea U4: I607_16940Help
Entry
I607_16940        CDS       T02720                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
amal  Alteromonas macleodii Ionian Sea U4
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    I607_16940
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    I607_16940
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    I607_16940
Enzymes [BR:amal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     I607_16940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3822581..3824275
Genome map
AA seq 564 aa AA seqDB search
MDRRTFIRLSSFAGASVAVSTGLAGCTVSTSANSQPQTKSEFTHGVASGDPLKDAVIIWT
RAVPTSSSALVKADILWEMASDAAFTDVVSSGVVEAKATHDFTVKVDVSGLQPASKYFYR
FKSANNVSPVGETRTLPEADVSKVTFGIFSCSNYPAGFFTPYMEAAKDDNMDYVLHLGDY
IYEYDGKGYATEHAKEIGRTYAPDNDTELYTLTDYRNRYALYRTDEGLLALHQNKPFIVV
WDDHEITNDTYKDGAENHQADEGDFYERRAAAVQAYYEWLPIRPPFGTERLEIYRQFTFG
NLLDLYMLDTRVLARDKQLEYANYRDAETKAFDQAGFMKDISNPNRGLLGETQRNWLHTS
MKQSQAKWQVLGQQLLIGRMLFPVSIFNGVERKEIPAHVHRLANIKRKQKQGAALSEQEL
ALINTVMPYNLDAWDGYPIEREHVLMQLKSIGKPVIALAGDTHNAWHNKLTLKDGTEVGV
ELATPGVTSPGMEHYLSMDDEMAETLADDLPLLIDDLQYCNLHQRGFMTLTVSEDEAKAT
WHYVDAILTKAGKVVNTHSFEIKA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggatagaagaacgtttattaggctgtcgtcattcgcgggtgcgagcgtggcagtatct
actgggctagcggggtgtacagttagcacgtcagcaaacagtcagcctcaaactaaatcg
gaatttacccatggcgtggccagtggcgacccgttaaaagatgcagtgatcatttggact
cgcgcggttcctacatcaagctcggctttagttaaagccgatattttgtgggaaatggca
agcgatgcagcatttaccgacgtggtaagtagcggagtcgttgaggctaaagcgacacat
gactttaccgtaaaagtagatgtgtcaggtcttcagcctgcaagcaaatacttttatcgc
ttcaaaagtgcgaataatgtgagccctgttggcgaaactcgtacattgccggaagcagac
gtttctaaggtcacattcggcatattttcttgctcgaactaccctgccggctttttcacg
ccttatatggaagccgccaaagatgacaacatggattatgtgctgcatttaggcgactac
atatatgagtacgatggaaagggttacgccaccgaacatgccaaagagattggccgaacc
tatgcgccagataacgataccgagctttatacgctaaccgactaccgaaaccgctacgcg
ttgtatcgcaccgacgaaggcttgctggctttacatcaaaataagccgtttatcgttgtg
tgggatgaccatgaaattactaacgacacctataaagacggtgctgaaaatcaccaagcg
gatgaaggcgatttttatgaacgtcgcgctgcggcagtgcaagcctattatgagtggctg
cctattcgcccgccatttggcactgagcgtttagaaatctaccgtcagtttacctttggc
aacctgcttgatttatacatgcttgatacccgcgttttagcccgggataagcagcttgaa
tacgccaactatcgcgacgctgaaactaaagcttttgaccaagcaggctttatgaaagat
atcagtaatcctaatcgcggtcttttaggtgaaacccagcgcaattggctacatacctct
atgaagcaaagccaggctaaatggcaagtgctggggcaacagctattaattggccgcatg
cttttccctgtatcgatatttaacggcgttgagcgtaaagaaatacctgctcatgtacat
aggcttgcgaatatcaaacgcaaacaaaagcaaggtgctgcactcagtgagcaagagctt
gcgcttatcaatacggtaatgccctacaacttagacgcatgggatggctatcctattgag
cgagagcacgtgcttatgcagctaaaatccatcggcaagccagttattgcccttgcaggc
gatactcataatgcttggcacaacaaactaacccttaaagacggaacggaagtgggtgtt
gaacttgccacccctggggtgacgtcacccggcatggaacattatttaagtatggatgat
gaaatggcagaaacacttgctgatgaccttccccttcttattgatgatttacagtattgt
aatcttcaccagcgcggctttatgacattgaccgttagcgaggatgaagctaaagcgacc
tggcactatgtggatgcaattttgaccaaggctggaaaggtggttaacacgcatagcttt
gagattaaggcatag

DBGET integrated database retrieval system