KEGG   Alteromonas mediterranea U8: I634_00265Help
Entry
I634_00265        CDS       T02722                                 

Definition
(GenBank) formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
amao  Alteromonas mediterranea U8
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:amao00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    I634_00265
Enzymes [BR:amao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     I634_00265
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     I634_00265
DNA repair and recombination proteins [BR:amao03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     I634_00265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
60735..61544
Genome map
AA seq 269 aa AA seqDB search
MPELPEVEVSRLGVSPHLIGNTITRVVVRERRMRWPIPQEVAKVEGQKATAVKRRAKYLL
IETAQGTLILHLGMSGKLRVIDASTPVIKHDHVDIVLSTGKCLRFNDPRRFGAVLYQAPD
THIPMLDNLGPEPLTDDFNDTRLFTLSRNRKGPVKNFIMDNAIVVGVGNIYANEALFLAG
IDPRRAAGNISAARYKLLTATIKQVLAKAIEQGGTTLKDFAQTDGKPGYFAQHLNVYGRK
GEPCEACGKAIESKVIGQRNTFFCTRCQR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaagtaagccgtttgggcgtctcaccacatcttattggc
aacacgattacccgtgttgtggttcgcgagcgaagaatgcgttggcctattccacaagag
gtggccaaggttgaggggcaaaaggccacggccgtaaagcgccgcgctaaatatctattg
attgagacagcgcagggtacgctaattttacacttgggcatgtcgggtaaactacgggtt
atcgacgcttctaccccagtgattaagcacgaccatgttgacatcgtgcttagcacgggt
aaatgtctgcgctttaacgaccctagacgcttcggtgccgtgctgtatcaagcgccagat
acacacattcccatgcttgataatcttgggcctgagccccttacagacgattttaacgat
acgcgcttatttaccctgtcacgcaaccgcaaaggcccagtgaaaaacttcattatggat
aatgctattgtggtgggggttggaaatatctatgcaaacgaagcgctatttttagcgggt
atcgatccaaggcgcgccgccggtaatatcagtgcagcccgctacaagttgttaaccgct
acaataaagcaagtgttggcaaaagccattgaacagggcggcactacgttaaaagatttt
gcgcaaacagatggcaagcctggctatttcgcccaacaccttaatgtctatggccgaaaa
ggagagccatgcgaggcgtgtggtaaggcgatagaaagcaaagtaatcgggcagcgcaat
accttcttttgtactcgctgccaacgttaa

DBGET integrated database retrieval system