KEGG   Alteromonas macleodii Ionian Sea U8: I634_02340Help
Entry
I634_02340        CDS       T02722                                 

Definition
penicillin-binding protein 1B
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
amao  Alteromonas macleodii Ionian Sea U8
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:amao00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    I634_02340
Enzymes [BR:amao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     I634_02340
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     I634_02340
Glycosyltransferases [BR:amao01003]
 Polysaccharide
  Bacterial polysaccharide
   I634_02340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
559484..561844
Genome map
AA seq 786 aa AA seqDB search
MTKRQTKNNSSSKSNASKKTAAGKSTTKRSWFFKLFWRVCLIGLVVLGAYAFYLDAQIKH
AFSGNKWEVPAQIFARPLEVSKGEEITPQEVIDELNLLGYRKVAFADSSGEYSYQNKVLT
VQRRAFQFPEGAEPLRHLVLTWEGARIGEIYDKSQGRPYGSVKLEPWLVTRMTSGSHEDR
MLVTLDTIPEMLPKALTLVEDRNFYNHHGVAPLSILRALMANIAAGRTVQGGSTLTQQLV
KNMFLTRERSLVRKAKEAIMAVIIDARYSKSEIIEAYLNEVFLGQNGDMAVHGFGLASYF
YFDRPANELSTPEIATLVAIIKGPSYYNPRKYAERTKERRDLVLRMLFDENEINRQDYER
YVNMPLGLASGASLASGKHPAFMEQVRKELNEILAEPSLRDSGVKVFTTLDIVAQRRAEK
ALSGTLNGLQKDRSVPLQGAMVVTDSASGEVRAIVGGKDFAFKGFNRALDAKRPIGSLIK
PAVYLTALEDPTQFNLATPLKDEPITLESRNGTEWSPQNYDKEFRGQVPLLQGLVESLNV
PTVNLGMQIGLDALADTIERLGVTTPVDKVPSLTLGAFELTPFSTNQMYQTLSNDGRYIP
LHTVSSVVTADNALLWKKAEFFAQRTDEAATYLLNYALYKVTTEGTAKRIGWNFGNVNMA
GKTGTTDDYRDSWFSGFDRNNVVTVWVGNDDNQPVNLTGAGGALPVFVNYMKSQSPKSLS
RRFPKGLGIAHFDAKTGAVVVAGCAGSLSVPAILDVLPPAQQDCAGRPVDENGDKKEKSW
WERIFG
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaagacagactaaaaacaattcatcttcaaaaagcaatgcttcgaaaaaaact
gcagcgggaaaaagtacaaccaaacgttcgtggttttttaaactgttctggcgtgtatgc
cttatagggcttgtggtgctaggggcatatgccttttatctcgacgcacaaattaaacat
gcgttctcgggtaacaagtgggaagtacctgcgcaaattttcgcacgtcctttagaagtg
agtaaaggcgaggagataacgccacaagaagtcattgatgaactcaatttgctgggctat
cgcaaggtggcttttgctgacagtagcggtgaatatagctatcaaaacaaggtgttaact
gtgcagcgccgcgcgtttcaattccccgagggagcggagcctcttcgacacttagtatta
acgtgggaaggggcgcgtatcggtgaaatatacgataagtcacaaggccgtccctacggt
tctgtaaagttagagccatggctagtaacacgcatgacgagcggctctcatgaagaccgc
atgttagtgacgttagatactatccctgaaatgttacctaaagcgctgacgctggtggaa
gatcgcaatttttataaccaccatggtgttgcaccactttcaatattgcgggccctaatg
gcgaatattgctgctggtcgtacggttcaaggtggtagcacgctgacgcagcagctggtt
aaaaacatgtttttaacccgcgaacgttctcttgtacgcaaggctaaagaggccataatg
gcggtcattatagacgcccgctatagcaagtctgagattatcgaagcctatttaaatgag
gtgtttttagggcaaaacggcgacatggctgtacatggatttgggcttgctagctatttc
tactttgaccgtccggccaacgagctaagcacgcccgaaatagccacgctggttgctatt
atcaaaggcccatcttattacaatccacgaaagtatgcagagcgcacaaaagagcgtcga
gatttagtacttcgaatgttgttcgatgaaaatgaaataaaccgtcaagactacgagcgc
tatgtgaacatgccgttagggcttgccagcggtgcgagtttagcaagcggtaaacaccct
gctttcatggagcaggttcgcaaagaactcaatgaaattttagcagagccaagcctaaga
gactcgggcgttaaagtgtttaccacactggatatcgttgctcaacgtagggcagaaaaa
gcattatcgggcaccctaaatggcctgcaaaaagatagaagcgttccattgcaaggtgcc
atggtagtcaccgacagtgcaagcggtgaagtacgcgctatcgtaggtggtaaagacttt
gcatttaaaggttttaatcgagcattagatgctaagaggccaataggctcattgattaaa
ccagctgtgtacttaactgccttagaagatcctacccagtttaacttggctacacccctt
aaagacgagccaattaccctagaaagtagaaacggcaccgaatggtcgccgcaaaactac
gataaagagttcagagggcaggtgcctctgcttcaggggttagtcgaatctttgaacgtg
ccaacagttaatttaggcatgcagataggcctagatgcgttagccgataccattgagcgg
ttaggggttaccacgccagtagataaagtaccgtcgttaaccttgggcgctttcgaacta
acgccatttagcacaaaccaaatgtatcaaaccctatcaaacgatggccgctacataccg
cttcacacggtgagctctgtggttacggcagataatgcattactttggaagaaggccgag
ttctttgctcagcgcacggatgaagccgccacttacttactgaactacgccctgtacaag
gtgaccacagaaggtacagcaaaacgcataggctggaactttggtaatgtaaatatggca
gggaaaacaggtacaaccgatgattatcgcgatagttggtttagcggtttcgacagaaat
aatgtggtgaccgtttgggtcggcaatgacgataatcaaccagtgaatttaaccggtgca
ggtggcgcgctgcctgtgtttgtaaattatatgaagtcacagtcaccgaagtctctatct
agacgtttccctaaagggttaggtattgcacatttcgatgcgaagacgggggcggtagtg
gtcgctgggtgcgcaggaagtttaagtgttccggctattttggatgtactgcctcctgcg
cagcaagattgtgctggtcgcccggtagacgaaaacggcgataagaaagaaaaaagctgg
tgggagcgtatatttggataa

DBGET integrated database retrieval system