KEGG   Alteromonas macleodii Ionian Sea U8: I634_04115Help
Entry
I634_04115        CDS       T02722                                 

Definition
Ubiquinol-cytochrome C reductase iron-sulfur subunit
Orthology
K00411  
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2]
Organism
amao  Alteromonas macleodii Ionian Sea U8
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome bc1 complex respiratory unit
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:amao00190]
Environmental Information Processing; Signal transduction; Two-component system [PATH:amao02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
955830..956462
Genome map
AA seq 210 aa AA seqDB search
MSNVSVDATESAHNENQPENNTRRRFLTVATSVVGGVGVVGAAVPFIASWNPSAKAKAAG
ADVEVDISGIEPGQLVRVMWRSKPVWIVRRTPEILEELGTHEDKLKDPNSEAEQQPTFAQ
NRFRSMKEEYLILVGICTHLGCSPQHLKDGAFEEVVEGVPDGFFCPCHGSKFDMAGRVFQ
NVPAPLNLVVPPYQFVDDNTVIIGSEAEVA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgtatctgtagatgcaacagagtctgcacacaatgaaaaccagccagaaaac
aacacccgtcgtcggttcttgaccgttgccacgtcggtagttggtggtgtaggtgtcgtt
ggtgctgctgtgccttttattgcgtcctggaatccgagcgccaaagcgaaagccgccggt
gctgacgttgaagtagatatcagcgggattgagcctggacagttagtacgtgtaatgtgg
cgaagcaagcctgtatggattgtacgtcgtacgccagaaattcttgaagaattaggcact
cacgaagataagctgaaagatcctaactctgaagctgagcagcaacctacttttgctcaa
aaccgttttcgctcaatgaaagaagaatacctgattctagtgggtatttgtacgcacctt
ggttgctctccacagcaccttaaagatggcgctttcgaagaagtggttgaaggcgtacca
gatggtttcttctgcccgtgtcacgggtctaagtttgatatggcaggacgtgtattccaa
aacgtaccggcaccattaaacctagttgtgccgccttatcagttcgttgatgacaacacc
gttatcatcggctcagaagcggaggttgcttaa

DBGET integrated database retrieval system