KEGG   Alteromonas macleodii Ionian Sea U8: I634_04115Help
Entry
I634_04115        CDS       T02722                                 

Definition
Ubiquinol-cytochrome C reductase iron-sulfur subunit
Orthology
K00411  
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2]
Organism
amao  Alteromonas macleodii Ionian Sea U8
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:amao00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    I634_04115
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    I634_04115
Enzymes [BR:amao01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.2  With a cytochrome as acceptor
    1.10.2.2  quinol---cytochrome-c reductase
     I634_04115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
955830..956462
Genome map
AA seq 210 aa AA seqDB search
MSNVSVDATESAHNENQPENNTRRRFLTVATSVVGGVGVVGAAVPFIASWNPSAKAKAAG
ADVEVDISGIEPGQLVRVMWRSKPVWIVRRTPEILEELGTHEDKLKDPNSEAEQQPTFAQ
NRFRSMKEEYLILVGICTHLGCSPQHLKDGAFEEVVEGVPDGFFCPCHGSKFDMAGRVFQ
NVPAPLNLVVPPYQFVDDNTVIIGSEAEVA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgtatctgtagatgcaacagagtctgcacacaatgaaaaccagccagaaaac
aacacccgtcgtcggttcttgaccgttgccacgtcggtagttggtggtgtaggtgtcgtt
ggtgctgctgtgccttttattgcgtcctggaatccgagcgccaaagcgaaagccgccggt
gctgacgttgaagtagatatcagcgggattgagcctggacagttagtacgtgtaatgtgg
cgaagcaagcctgtatggattgtacgtcgtacgccagaaattcttgaagaattaggcact
cacgaagataagctgaaagatcctaactctgaagctgagcagcaacctacttttgctcaa
aaccgttttcgctcaatgaaagaagaatacctgattctagtgggtatttgtacgcacctt
ggttgctctccacagcaccttaaagatggcgctttcgaagaagtggttgaaggcgtacca
gatggtttcttctgcccgtgtcacgggtctaagtttgatatggcaggacgtgtattccaa
aacgtaccggcaccattaaacctagttgtgccgccttatcagttcgttgatgacaacacc
gttatcatcggctcagaagcggaggttgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system