KEGG   Alteromonas macleodii Ionian Sea U8: I634_09585Help
Entry
I634_09585        CDS       T02722                                 

Gene name
sucA
Definition
2-oxoglutarate dehydrogenase E1 component (EC:1.2.4.2)
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
amao  Alteromonas macleodii Ionian Sea U8
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    I634_09585 (sucA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I634_09585 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    I634_09585 (sucA)
   00380 Tryptophan metabolism
    I634_09585 (sucA)
Enzymes [BR:amao01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     I634_09585 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2170846..2173665
Genome map
AA seq 939 aa AA seqDB search
MQESVMKAWWDSSHMAGANAAYVEELYETYLEDPQSVSENWRQIFDNLPKVDGVELETNH
TTIKNQFRQLAALGPTARMSSPSSPSANVSDDRQVKVLQLINAFRFRGHQHANLDPLGLW
QQERVRDLELSHHSLSEQDFDSVFNVGSYAIGKESMPLGELFKSLNRTYCGSIGAEYMHI
TDTEQKRWLQQKIESVQAKPEISRDEKLGILKGLTAADGMEKYLGSKFPGAKRFSLEGGD
ALIPMLKGLITKAGTAGTKEVVIGMAHRGRLNVLVNVLGKNPSVLFDEFSGKHDDSLGAG
DVKYHAGFSSDFATPGGNVHLALAFNPSHLEIVNPVVMGSVRARLARRDNDTNTVLPITI
HGDSAIAGQGVVQETFNMSQTRGFAVGGTVRIVVNNQVGFTTSKTEDTRSTQYCTDIAKM
VQAPIFHVNSDDPEAVAFVTQLALEYRNKFKKDVVIDLVCYRRHGHNEADEPNATQPLMY
QKIKKHPVPRVLYADQLIAEGVIEQRDADRYLEEYREALDHGACVVEEWRPMTEHSVDWS
PYLGHDWDTPYDGALSVEKLKELGESITTIPEDHKLQSRVNKLYQDRKAMVAGEKKLDWG
MAENLAYATIVDAGEDIRITGQDSGRGTFFHRHAVLHNQKDASTYMPLQHIREGQGEIEI
YDSVLSEEAVMAFEYGYATAEPTCLTIWEAQFGDFANGAQVVFDQFLSSGEAKWGRLCGL
TVLLPHGYEGQGPEHSSARLERFLQMCADHNWQVCVPSTPAQVYNMLRRQVVRPMRKPLI
VMSPKSLLRHPMAVSSLEELAEGKFHNVIDEIDDIDPKNVKRVVMCSGKVYYDLLDQRRK
NEQTDVAIIRLEQLYPFPQEECAKVVAQYSHVKDWVWCQEEPQNQGAWYCSQHHFWQAIP
DGAKLTYAGRDASSSPAVGYVSVHNQQQKALVENALTIK
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaagcgtgatgaaagcgtggtgggattcctcgcacatggcaggtgccaacgct
gcctatgttgaagagttgtatgaaacctatttagaagacccgcaaagtgtctctgaaaat
tggcgacaaatcttcgataacctccccaaagtcgatggcgtagagttagaaaccaatcat
acaactattaagaatcaatttaggcaacttgctgcgttagggccaaccgcccgcatgtct
agtccgtcttctccttctgctaatgtctcagacgacaggcaagttaaagtccttcagtta
attaacgcgttccgcttccgcggtcaccaacacgcaaacttagacccacttggtctatgg
cagcaagagcgtgtgcgcgacttagaactttctcaccacagcctatctgagcaagatttc
gattcggttttcaacgtgggttcttatgctatcggcaaagagtcaatgccacttggagaa
ctgtttaaatcgcttaacagaacttactgcgggtctatcggtgcagagtacatgcacatt
accgacactgaacaaaagcgttggttacagcaaaagatagaatctgttcaggccaagcct
gaaatttctcgtgatgagaagttaggtattcttaaaggtcttactgcggccgacggcatg
gaaaaatacttgggttctaaattcccaggtgcaaagcgtttctctctagaaggcggcgat
gcgctaattcctatgcttaaaggcttgatcacaaaagcgggcactgcgggtaccaaagaa
gtggttatcggcatggctcaccgtggtcgattgaacgtattggtaaacgtactgggtaaa
aacccgtcagtactgtttgacgaattctctggtaaacacgacgactcgctaggtgcgggt
gacgtgaaataccacgccggtttctcttcagactttgcaacgccaggtggcaatgttcac
ctagcgctagcgtttaacccgtctcaccttgaaattgttaacccggtagttatggggtcg
gtacgcgctcgtttagcacgtcgtgataacgacactaacacagtgttgccaataactatc
cacggtgactctgctattgcgggtcagggtgtagttcaagaaacctttaatatgtcacaa
actcgcggctttgctgtgggtggtaccgttcgcattgtggtaaacaaccaagttggcttt
accacgtcgaaaacagaagatacccgttcaacgcaatactgtaccgacatcgcgaaaatg
gtgcaggcgccaattttccatgttaactcagatgacccagaagcggttgcctttgttaca
cagcttgcgcttgagtatcgcaacaagtttaagaaagacgtggtaattgaccttgtttgt
taccgtcgtcatggtcacaacgaagcggatgagccgaatgcaacgcagccgttgatgtac
caaaaaattaaaaagcaccctgtaccgcgtgtgctatatgctgaccaacttatagctgaa
ggcgtaattgagcaacgggatgcagaccgctaccttgaagagtatcgtgaagcgttggat
cacggcgcttgtgttgtagaagagtggcgtccaatgaccgagcacagtgttgactggtct
ccatatcttggacacgactgggatacgccttacgatggcgcactttcagttgagaagctt
aaagagctaggtgagtcaatcactactattcctgaagatcataagcttcagtctcgtgta
aataagctgtaccaagaccgtaaggctatggttgcaggcgagaagaagttagattggggg
atggctgaaaacttagcctatgccactatcgttgacgccggcgaagatattcgcattacg
ggtcaggattctggccgtggtactttcttccaccgtcacgcggtattacacaatcaaaaa
gacgcatcgacgtatatgcctctgcagcatattcgtgaaggtcagggtgaaattgaaatt
tacgactctgtgctttcggaagaagcagtaatggcatttgaatacggctatgcgacggca
gagccaacgtgcctgaccatttgggaagcccagtttggtgacttcgctaacggcgcacag
gttgtattcgaccaattcttaagttcaggtgaagcaaagtggggccgtttgtgtggtcta
accgttttacttccacatggttatgaaggtcaaggcccagagcatagttctgcacgcctt
gaacgtttccttcagatgtgtgctgatcacaactggcaagtgtgtgtgccttctacacct
gcacaggtatacaacatgcttcgtcgccaagtggttcgcccaatgcgtaaaccgcttatc
gtcatgtcgcctaagtcattattacgtcacccaatggcggtatcttcgttagaagagcta
gcggaaggtaaattccacaacgtgatagatgaaattgacgacattgatccgaagaacgtg
aagcgtgttgttatgtgttcgggcaaggtttactacgatttgttagaccagcgacgtaaa
aatgagcaaacagacgttgcaatcatccgtttagagcaactttatccattcccacaagaa
gaatgcgctaaagttgtggcacaatacagccatgtaaaagattgggtttggtgtcaagaa
gagcctcaaaaccaaggcgcttggtactgtagccaacaccatttctggcaagcaattcca
gatggtgcgaaattaacatatgcaggccgtgatgcatcctcgtcacctgcagtaggttat
gtatccgttcacaaccagcaacagaaagccctggttgaaaacgcactcacaattaaataa

DBGET integrated database retrieval system