KEGG   Alteromonas macleodii Ionian Sea U8: I634_10150Help
Entry
I634_10150        CDS       T02722                                 

Definition
NAD-specific glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
amao  Alteromonas macleodii Ionian Sea U8
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amao00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    I634_10150
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I634_10150
   00330 Arginine and proline metabolism
    I634_10150
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    I634_10150
Enzymes [BR:amao01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     I634_10150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2317292..2322130
Genome map
AA seq 1612 aa AA seqDB search
MTVTSQRHSVLLDNVFALIDKKVDTKQKSLVQQFGRLLYKNISSDDLENRNDSDLYGATL
SLWNGLAKFDNTSPYIRVFNPEIAKHGWHSSHTIVEIIVSDMPFLVDSVRMLLNRLNITA
HLFLHSPIGIKRDNSNKVDAFAEPGKIINGAKKETVLFIEIDTQTSKKDIDALTQELYSV
VDEVSLAVKDWQGMTNTLQEVIKKSATFNWPVSADAKKQTKAYLEWLGDHNFTMMGYRYY
DVKAIEGDHRWIPQNDTSLGLLKNSINDRERLLSRLPASARAEALSKNPLILTKTNSRAR
VHRPAYMDYVGVKEFNKVGQVVGEHRFLGLYSASFYNNSVTQLPILREKIKRICELSGFE
PGTHAYKAFANIIETYPRDELLQTPAEELAQIVMGIFQMQERGISRLFIRKDTFGRFFSC
MVFVPRERYNTELRKETQALLKASLGAAEEVEFTTFFSESVYARTHYIARVNDNNAEFDV
KEIEQNIIELTKTWNDRLASAISAAHGEASGKALERKYNNAFSRSYMEHNLPSAALVDIG
KLETLDDNHTLDMLFYRPQEEGADSQVVKLKLFHRAEPIHLSDVLPMLENFGLRVIDESP
YKITCSEGERNWVMDFTMLHKSGQHFDMEKAQVLFQDAFAKVWYKTLEDDAFNRLILGAN
MTGRKVTVLRAYAKYMRQTGSSFSRDYIANTLANYPDIARLLVDFFDQRFNPKKKRSEKK
EEALLDTIKAQLDNVSNLDDDRIIRRYLDMMSATLRTNFYQNDEAGDEKSYVSFKMMPEL
IPEMPLPLPKFEIFVYSPRVEGVHLRGGKVARGGLRWSDRQEDFRTEVLGLVKAQQVKNT
VIVPVGAKGGFVCKNLPVGQGREAIQAEGQACYRIFITSLLDITDNIVNGEIVPPKDVVR
LDDEDPYLVVAADKGTATFSDIANGIAEDFGFWLGDAFASGGSIGYDHKKMGITARGGWE
SVKRHFREIGIDCQTTDFTCAGVGDMAGDVFGNGMLLSEHTRLIAAFNHMHIFFDPNPDA
AASYKERQRLFENPRLSWEDYDSKLISKGGGVFSRASKSIKLTPEMKKWLGTRQLTMTPN
ELIHNILKMPVDLLWNGGIGTYIKSKKESHSEVGDRANDDLRVNGRDVQAKIVGEGGNLG
LTQLGRIEYAANGGRVNTDFIDNVGGVDCSDNEVNIKILLNSLVNDGELTLKQRNKLLYD
MTDDVSEIVLKDCYRQTQSISITELAGVKQLKEQLRFIHGLEREGQLNRELEFIPSDDEI
SDRVATDQGLTRPELSVLIAYGKMVLKDALNIPEITDNAYHGKLLVEAFPKILREKFATH
MQQHPLRSEIIATKLTNNMVNDMGLNFVFRMQEETGASVSEIANAYAIVHGIFNMKTLWA
RIEELDNAIPAKLQLKMLDEARRTMRRASRWYIRHGNKSQSIEEAIESYRGTFDILSKNL
QHYLVESEYKQLEAATQQYIDKGVPQDIAYQVASFSNMFSSFDLAQIVEADKHDTDVVAK
LYYQLGSRLELHWFLDQINNQAVSNHWQALARASYREELDWQQRSIAANLLASRGDISDA
DQILDEWIESNQVLLKRWYQMMSEFKTSTTHEFAKFSVALRELMLLSVKSNH
NT seq 4839 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcacctcacagcgacactcagtactgctagacaatgtatttgcacttatcgac
aagaaagtagataccaagcagaagtctcttgtgcagcaattcggacgtctgttgtataaa
aacatatcaagcgatgacttagaaaatcgcaacgacagcgacctgtatggtgcaacactt
agtttatggaacggactagcaaagttcgataatacatcgccttatattcgcgtttttaat
ccagaaatagcaaagcatggatggcactctagtcatacgattgttgaaattatcgtttcg
gatatgccatttttagttgattctgtgcgtatgttgctgaaccgactaaatattaccgct
catttatttcttcatagccccattggcatcaagcgagacaactcaaacaaagtcgacgcg
tttgcagagccggggaagattattaatggcgcgaaaaaagaaaccgttttgtttatcgaa
attgatacacaaacgtcgaaaaaagacattgatgcattaacgcaagagctttattcagtg
gttgatgaagtgtctctagccgtcaaagactggcagggaatgaccaacacactacaagaa
gtgataaaaaagagcgctacgtttaattggcctgtttctgcagacgcgaaaaagcaaact
aaagcgtatttagagtggctgggcgatcataacttcaccatgatgggctatcgttattac
gacgttaaagctattgaaggtgatcatagatggataccgcaaaacgatactagccttggg
ttgctaaaaaactcgattaatgaccgagaacgtttgttgtctcgcttgcctgcttcagca
agagccgaagctcttagcaagaatccgttaattctaactaaaaccaattcacgcgctcgc
gtacaccgacctgcctacatggattacgtgggtgttaaagagtttaataaagttggtcaa
gttgtgggagagcatcgtttcctaggtttgtattcggcttctttttacaataatagcgtt
acccaactacctattcttcgagagaaaattaagcgaatctgtgagctctcaggttttgaa
ccaggtacccatgcctacaaggccttcgcaaacattattgagacctatcctcgtgatgag
cttcttcaaacgccggcagaagaacttgctcaaattgtaatgggcatctttcagatgcaa
gagcgcggtatttctcgtctgtttattcgaaaagatacatttggccgctttttctcatgc
atggtttttgttccaagagagcgctacaacactgagctaagaaaagaaacacaagcgctt
ttaaaagcgtccttaggtgcagcagaggaagtggaatttactactttcttctcagagtct
gtatatgcccgtacgcactatattgcgagagtcaacgacaacaacgcggaattcgatgtg
aaggaaatagagcaaaacattattgagttgaccaaaacgtggaacgacagactagcgtca
gcaatttcagccgcccacggtgaggcgtcaggcaaagcgctagaacgcaagtataacaac
gcgttctctcgaagctacatggaacacaaccttccatcggctgcactggttgatatcggc
aaacttgagaccctagacgacaaccatacccttgatatgctgttctatcgtccgcaagaa
gaaggcgccgacagtcaggtggttaagcttaagcttttccatcgcgcagagcctattcac
ttatcagacgttttgcctatgcttgagaattttgggttacgcgtaatcgacgagagccca
tataaaatcacatgttcagaaggtgagcgtaattgggtcatggacttcaccatgctgcac
aaaagcggccagcattttgacatggaaaaggcgcaagtcctgttccaagacgcgtttgca
aaggtgtggtacaaaacgttagaagacgacgcattcaaccgccttattttaggcgcgaac
atgacggggcgtaaggtaaccgtattgcgcgcttatgctaagtacatgcgtcaaaccggt
agctccttcagtcgtgactatattgctaatacgttagctaattacccagacattgcccgt
ttactggtggactttttcgaccagcgcttcaatccgaagaaaaagcgtagtgagaaaaaa
gaagaggcacttttagacaccatcaaggcacaactagacaacgttagtaacttagatgac
gaccgtataattcgtcgttaccttgatatgatgtctgccactttgcgcacgaacttctat
cagaatgatgaagcaggcgatgagaaatcttatgtctcatttaagatgatgcctgaactt
attcctgaaatgccgctgcctttaccgaaatttgaaatttttgtttacagcccgcgggtt
gaaggtgtgcaccttcgaggcggtaaagttgcacgcggtggcctacgctggtcagaccga
caagaagacttcagaaccgaagtacttggcctggtaaaagcacagcaagttaaaaatacg
gttatcgtaccggttggcgcaaaaggtgggtttgtctgtaagaatctgcctgtaggccaa
gggcgcgaggctatccaagcagaaggtcaagcatgttatcgcatctttatcaccagctta
ctggatattaccgataacattgttaacggtgaaattgttccacctaaagatgtagttcgc
cttgacgatgaagacccttacttggtggttgcggccgacaaaggaactgctacgttctct
gatattgctaacggtatcgcagaagactttggcttttggttaggtgatgcgtttgcctct
ggtggtagcattgggtacgaccataagaaaatgggtatcactgctcgtggcggctgggaa
tcggttaaacgccactttagagagattggcatagactgccagactactgatttcacctgc
gcgggtgtgggtgatatggcgggcgatgtgtttggcaacggtatgctgctttcagagcac
acccgtttgattgctgcatttaaccacatgcacattttcttcgatcccaacccggatgca
gctgcgagttacaaagaacgccaacgcctgttcgaaaacccacgccttagctgggaagac
tacgatagcaagctgatatcgaaagggggcggtgtatttagtcgtgcgtcaaaatctatc
aaactaacgcctgaaatgaaaaagtggttaggcacacgtcagttaacgatgacccctaat
gaacttattcataacattctaaagatgccagtagatcttctttggaatggcggtattggt
acctacattaagagcaaaaaagaatcgcattctgaagtaggcgatcgcgccaacgacgac
ttacgcgttaatggccgcgatgttcaagcgaaaattgtaggcgagggtggcaaccttggc
ctaacccaattaggtcgaattgaatatgccgcaaacggcggtcgtgttaataccgacttt
attgacaacgtaggtggcgtcgactgctcagataacgaagtaaatattaaaatattgctt
aatagtttggttaacgacggtgagctaacccttaagcagcgcaataagttgctttacgat
atgaccgacgatgttagcgaaattgtacttaaagactgctatcgccaaacccagtctatc
tccattaccgagctagctggcgttaagcagctaaaagagcaacttcgcttcatccatggc
ttagagcgcgaaggccagttaaaccgcgaactggaatttattccaagtgatgatgagata
tcagaccgcgtggcgaccgatcaaggtttgacgcgtcccgagctgagcgttttgattgct
tacggaaaaatggtgcttaaagacgcactcaatattcctgaaattactgacaatgcttac
cacggcaagctattagtagaagcgttccccaaaatactgcgtgagaagttcgctacacac
atgcagcaacacccgcttcgaagcgaaatcattgcaacgaaattaaccaacaatatggtt
aatgacatgggccttaactttgtatttagaatgcaagaagaaacgggtgccagcgtcagc
gaaattgccaatgcctacgctattgtgcacggtatcttcaacatgaagaccttgtgggcg
cgtatagaagaattagacaatgcaattccagcaaaacttcagcttaaaatgctagatgaa
gcgcgcagaacaatgcgtcgcgcgtcgcgttggtacattcgacacggcaataagtctcaa
agtatcgaagaggcaattgaaagctatcgcggcacctttgatattctttctaagaatttg
cagcactatttagtggaaagtgagtacaaacagcttgaagctgccacccaacaatatatt
gataagggtgtgccacaagatatcgcctatcaagtggcgagcttctcgaatatgttctct
agtttcgacctggctcaaattgtggaagcagacaagcacgatacggatgttgttgctaag
ctttattatcaactgggctctcgtttagaactgcattggttcttagatcagattaacaat
caggctgtaagtaaccattggcaagcgttagcacgtgcctcatatcgagaagagcttgat
tggcaacagcgctctatcgccgctaacttattagcgtcacgtggggatataagcgacgct
gatcaaattttagatgaatggattgaaagtaatcaggtactacttaagcgctggtatcaa
atgatgtcagagtttaagaccagtacgacacacgaatttgcgaaattttctgtcgcttta
cgtgaattgatgcttttaagcgtgaagtctaaccattag

DBGET integrated database retrieval system