KEGG   Alteromonas mediterranea U8: I634_11195Help
Entry
I634_11195        CDS       T02722                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00220  Arginine biosynthesis
amao00250  Alanine, aspartate and glutamate metabolism
amao00290  Valine, leucine and isoleucine biosynthesis
amao01100  Metabolic pathways
amao01110  Biosynthesis of secondary metabolites
amao01130  Biosynthesis of antibiotics
amao01210  2-Oxocarboxylic acid metabolism
amao01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amao00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I634_11195
   00290 Valine, leucine and isoleucine biosynthesis
    I634_11195
   00220 Arginine biosynthesis
    I634_11195
Enzymes [BR:amao01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     I634_11195
    2.6.1.66  valine---pyruvate transaminase
     I634_11195
Amino acid related enzymes [BR:amao01007]
 Aminotransferase (transaminase)
  Class I
   I634_11195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGP93944
Position
2539670..2540890
Genome map
AA seq 406 aa AA seqDB search
MKTVSRSHKLDNVCYDIRGPIAAQARKMEDEGHRILKLNIGNPAPFGFEAPDDIVKDVIH
NLPTSQGYSDSTGIYAARVAVMQYYQQRNIKDIRVDDVYIGNGVSELIMMAMQALLNHGD
EVLIPSPDYPLWTAAVSLSSGSPVHYRCDEQAGWFPDIDDIKSKITSKTRAIVLINPNNP
TGAVYDKALLQEVVEVAREHGLVVFSDEIYDKILYDEAQHTSIASLADDVFFVTFGGLSK
NYRVAGFRSGWLVVSGNKRLASDYIDGLNILSSMRMCANVPCQSAIQTALGGYQSINDLV
NENGRLRIQRDVTTDMLNGIDGISCVKPKGAMYCFAKVDEKKFNIHNDEQMVLDLLSSEK
ILLVHGRAFNLTEGTYFRLVFLPHSDVLVPALHRIGNFFRTYKQGA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgtatctcgctcacataaattagataacgtttgttacgacatcagaggccct
attgctgcgcaagcaagaaaaatggaagatgaaggtcaccgcattttaaaattaaatatc
ggtaaccctgccccatttggttttgaagcccctgacgatatcgtaaaagacgttattcat
aacctgcccacgtctcaaggctattcagactcaacaggaatttatgccgcccgcgtagcc
gtgatgcagtactaccagcagcgcaacatcaaagatattcgcgtagatgatgtgtacata
ggaaatggtgtttctgagcttattatgatggcaatgcaggctttgctaaatcatggtgac
gaagtactgatcccgagcccagactatccgctgtggacggcagcagtaagcttgtcttca
ggttctccagtgcattaccgctgtgacgagcaggcaggctggttccccgatatcgacgac
atcaaaagcaaaattaccagtaaaacccgcgcgattgttttaattaatccaaacaaccca
actggtgcggtatacgacaaagcactattacaagaggtggttgaggttgcccgagaacat
ggtttggtagtattcagtgacgaaatttacgataaaattttgtacgacgaagcccagcac
acaagcatagcatcattggctgacgacgtattttttgtcacgttcggcggtttaagtaag
aactaccgcgtagcagggtttcgctctggctggctagtagtaagtggaaacaagcgactg
gcatctgactatattgacgggctgaatattctctcttccatgcgaatgtgtgccaacgtg
ccgtgccaaagtgcaatacaaactgcacttggcggctatcaaagcatcaacgatttagtt
aatgaaaatggacgactgcgcatacagcgcgacgttaccaccgatatgctcaatggcatc
gacggtatttcatgcgttaaacctaaaggtgcaatgtactgtttcgccaaggtggatgag
aagaagtttaacattcacaatgatgagcaaatggtactggacttattaagctccgaaaaa
attcttttggttcacggtcgcgcgtttaacctaaccgaaggtacctatttcagattggta
tttttacctcacagtgacgtactcgtaccggcattgcaccgtataggcaacttctttaga
acctataagcaaggggcatag

DBGET integrated database retrieval system