KEGG   Alteromonas macleodii Ionian Sea U8: I634_14445Help
Entry
I634_14445        CDS       T02722                                 

Definition
Sugar kinase, ribokinase family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
amao  Alteromonas macleodii Ionian Sea U8
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:amao00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    I634_14445
Enzymes [BR:amao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     I634_14445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3292319..3293215
Genome map
AA seq 298 aa AA seqDB search
MAIINFGSINIDHVYQVDHFVQPGETLASTHYQTLLGGKGANQSIALAQAGADVRHVGSI
HENDASFKQALIKKGVDCRGVKCSEVPSGHAIIQVTPSGENAIVLFGGANQTITAKTVMQ
ALDDTRPSDWVLTQNETSSIEEVLRQAKENQLKVAFNPAPMSESVKQLPLDCVDLLIVNE
TEAAAITGKEEFEEIVTVFKEQWSHCEVIITLGKAGVMMLRKDDVIKVNAFTVDAVDTTA
AGDTFIGYFLSAYSSHTDAKQALRRGCAASAIAVTREGAAQSIPSQKEVDRFLAKHAN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcaataataaattttggctctatcaatatcgaccacgtttatcaggtagatcacttt
gtgcaacctggtgaaacgctagcctcaacccattaccaaacgttattaggtggtaagggc
gcaaaccaatctatcgctttagcgcaagctggtgccgacgtacgtcatgttggcagcatt
cacgagaacgatgcatcattcaaacaagccttaattaaaaaaggcgttgattgccgtggt
gttaaatgttcagaagtcccttctgggcacgcaatcattcaagtaacgcccagtggtgaa
aacgccatcgtactgtttggaggcgcaaaccaaacgattaccgcaaaaacggtaatgcag
gcgctagatgacacacgcccttctgattgggtacttactcaaaacgaaacaagtagcatt
gaagaagtactgcgccaagcgaaagaaaaccagctaaaagtggccttcaaccctgcccct
atgagtgagtctgttaagcagctcccgttagattgcgttgatttactaattgtaaacgaa
acggaagcagcggctattaccggcaaagaagaatttgaagaaattgtgacagtgttcaaa
gaacaatggtcacattgcgaagttatcattacactgggtaaagcgggtgtaatgatgctg
cgtaaagacgacgttataaaagttaacgcctttacggtagatgcagttgatacaaccgca
gcaggcgacacctttatcggttactttttgtctgcctacagcagccacaccgatgctaag
caagcactccgtagagggtgtgccgcgtcggcaattgcagtaacccgtgagggcgcagcg
caaagtattccatcacaaaaagaagtggatcgtttcttagcgaaacacgccaactag

DBGET integrated database retrieval system