KEGG   Alteromonas macleodii Ionian Sea U8: I634_16205Help
Entry
I634_16205        CDS       T02722                                 

Definition
delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
amao  Alteromonas macleodii Ionian Sea U8
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:amao01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:amao01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3709572..3710699
Genome map
AA seq 375 aa AA seqDB search
MKKPPLILTNALVFIISGAIAFIGVPLWVAYQGIDWAEIGTAIFLFYFTGMSITAGYHRL
WSHKTYDANIVVRIILAIGGAMALQNSILHWSSDHRVHHRHVDDNDKDPYSAKKGLWFAH
IGWMLREYQAKRYDDYSNCKDLQKDSVVMWQHKYYLPIVLAANFGITGLLGYLNGDVMGM
ILVAGVLRLVLVHHVTFFINSLAHFWGSQPYTDKNTARDNGVLAFFTFGEGYHNYHHIFE
YDYRNGIRWYQFDPTKWLIKGLSYVGLTSNLRKVPEERIEKALAAMQLQRASEKVSVLPN
AEEMMHTIQEEYDLLMQRMSEYYATKKRVMRVKQRTLKRSIEGLELAYKYKELKHAFAVQ
KEKWTHLQSLSLQMA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacctcctcttatcctaactaatgcgctggtatttataatatctggcgcaata
gcatttattggtgtgccgctatgggtggcgtatcaaggcattgattgggcagaaattggt
actgctatatttctgttctactttaccggcatgtcgattactgctggttatcaccgtctg
tggtctcacaagacctacgatgcaaacattgttgtacgcatcattcttgctatcggcggc
gctatggccttgcagaatagtattttgcattggtcttctgatcaccgtgtgcatcaccgc
catgtagacgacaacgacaaagatccttactctgcaaagaaagggctttggttcgcgcac
atcggttggatgttacgcgagtatcaagctaagcgttacgatgactacagcaactgtaaa
gacctgcaaaaagatagcgtggtgatgtggcagcacaaatactacttacctatcgtactc
gctgctaactttggcattactggtctattaggctatttgaacggcgacgtgatgggcatg
attttagtagcgggcgttcttcggttggtgctagttcatcatgttacgttttttattaat
tctctggcccatttttggggtagtcagccttataccgataaaaatacggcgcgagataat
ggcgttttagctttcttcacgtttggcgagggttatcacaactaccaccatatctttgaa
tacgattaccgcaacggcattcgttggtatcagtttgatcctactaaatggctaatcaaa
gggctgtcttatgtaggtttaacgtcgaaccttcgcaaagtacctgaagagcgcatcgaa
aaggcactggcggccatgcagcttcaaagggctagtgagaaagtatcggtactgcccaac
gctgaagaaatgatgcacactattcaagaagagtacgacctgcttatgcagcgaatgagt
gaatactacgcgacgaaaaagcgcgtgatgcgtgttaagcaacgcaccttaaaacgcagt
attgaagggttagaacttgcgtataagtacaaagaactgaagcacgcgtttgctgtgcag
aaagaaaaatggacacatttgcaaagcttatcgttacaaatggcctag

DBGET integrated database retrieval system