KEGG   Alteromonas mediterranea U8: I634_16430Help
Entry
I634_16430        CDS       T02722                                 

Definition
(GenBank) endoglucanase Y
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
amao  Alteromonas mediterranea U8
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3752206..3753306)
Genome map
AA seq 366 aa AA seqDB search
MVTGFKATKTLLAIALTLLLVSCSTKEDNAFKSQFMAYKALFIDGGRVVDTGNDEVSHSE
GQGYGMLFAVAADDKDTFDALWHWTQRTLLRSDGLFSWRYRPCADNSESCIDDPNNASDG
EILIAWALLRASEKWGIKGYQDEAGKIVQAVEQKLLVEHQGSVMLLPGEYGFTSQSEGQK
SLQLNLSYWVFPALTDLSALSNTPSRWQKLHQTGLTLLSNMQFSSYQLPSDWVRFEPRNS
GSAKSGLSGELTLTDVVSAEFGFNAIRIPLQLVWSEQVRDNAALAEELLTPYYQWWAKAP
TPATVNLLTEQTAEYEMTPGMQSVKLAVKYLMKSEEPVWPTVNRKMDYYSASLTLLSMLA
VSDNAS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccggatttaaggcaacaaaaacgctgctggcgatagcactaaccctattgtta
gtgtcgtgctccacaaaagaagacaatgcttttaaatcgcaatttatggcgtataaagcg
ctatttatcgacggcgggcgtgtggtagatacgggaaacgatgaggtgtcgcacagcgaa
gggcaaggttacggcatgttattcgctgtagcagccgacgacaaagataccttcgatgcc
ctatggcactggacccagcgcacgcttttgcgcagcgatgggcttttcagctggcggtat
cgcccatgtgccgataattcggagtcgtgtatagacgacccgaataatgcatcagatggc
gagattttaattgcatgggccttgttacgggccagtgaaaaatggggaataaagggatat
caagacgaagcgggtaagattgttcaggctgtagagcaaaagctgttggtagagcatcaa
ggtagcgtgatgttactacctggtgagtacggcttcacctcacaaagcgaggggcaaaag
agcctccagcttaatctgtcatactgggtttttcccgcacttacagatttatctgcctta
tccaatacaccgtcgcgatggcaaaagctccatcaaactgggcttactttgctttcgaac
atgcaattttcatcctatcaactgccaagcgactgggtgcgttttgaaccccgcaatagt
ggttcagcaaagtcagggttatccggtgaactcaccctaactgacgtggtatctgcagag
tttggctttaacgctattcgcattccgctgcagttggtatggtctgaacaggttcgtgac
aacgcggctttagccgaagaacttcttacgccctattatcaatggtgggcaaaagcgcct
actccagccaccgtcaatctacttaccgagcaaaccgctgaatatgagatgacacccggc
atgcagtcggtgaagttagccgtcaagtaccttatgaaatctgaagaaccagtgtggcca
acagttaatcgcaagatggactattactcggccagtttaacgctgctctctatgctagcg
gtgtcggataacgcatcgtga

DBGET integrated database retrieval system