KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_00545Help
Entry
AMBAS45_00545     CDS       T02253                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AMBAS45_00545
Enzymes [BR:amb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AMBAS45_00545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
123585..124226
Genome map
AA seq 213 aa AA seqDB search
MASLLGNLFILAAPSGAGKSSLIKALMEKYESNTATPMQVSVSHTTRQPRPGEVDGVHYH
FVSREQFEALIEQGVFFEYAEVFGNYYGTSRVTIEQTLHRGIDVFLDIDWQGARQVKKLM
PDTCGIFILPPSLDVLEQRLNNRGQDSEEVIAGRMAQAVAEMSHFNEFDSVIINDDFATA
LNDLEAIVTAQRLRTGKQQMRHQVLLDELLGSA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactactcggcaacttattcattcttgcggctccttctggagcaggaaaatca
agccttataaaggcgctaatggaaaagtatgaaagcaatacagctacgccaatgcaggtg
tctgtatctcatacaacacgtcaacctcgtccgggtgaagtcgacggcgtgcactaccat
ttcgtgagccgagagcagtttgaagcgctgattgaacagggtgtgttttttgaatacgca
gaagtatttggcaattattacggcacatcccgcgtgacaattgaacaaactttgcaccgt
ggtattgacgtatttttagatatcgattggcagggcgcgcgccaagtcaaaaagcttatg
ccagacacatgcggtattttcattcttccgccttcactcgacgtgctagagcagcgttta
aataatcgcggtcaagacagtgaagaagtcattgcagggcgtatggcacaagccgtagct
gaaatgtctcatttcaatgagttcgatagcgtaattattaacgacgactttgcgactgcg
ttaaacgatttggaagccatcgttacagcacagcgacttcgcacgggaaaacaacaaatg
cgccatcaagtgctattggacgaactgctcggtagcgcgtaa

DBGET integrated database retrieval system