KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_00960Help
Entry
AMBAS45_00960     CDS       T02253                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:amb00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:amb00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:amb00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(214274..216403)
Genome map
AA seq 709 aa AA seqDB search
MSSLTSFVRLSNEKATLIFDCQGRMPKVIYYGAPLSDSTTPEMLSVLNTRQEAKCAPVIE
PPITLVPTHGDGWTGQPGLEVSGDADQWSAGFSLTEINEDAQSVAFVSEDARRGMRLITT
VELDNKTSVVKYVSRLENSGETPLNLGYLNAASLPLPTSVSKIKTFEGRWSAEFQTKDHD
LFFGSYVRENRRGKTSHDTFPGLIAFPQGTGELNGECYGYHLGASANHKLRAELMADGRS
YVQFGELLFPGEVVLNAGESYTSPVLYTGYGCEGFSSLSQQFHNFIRSNVLNHSAESKPR
PVHYNTWEGIYFDHNEDELKALADKVAPLGIERFVLDDGWFKGRRNDKAGLGDWFVDEAI
YPEGLDGLIDHVTGLGMEFGIWFEPEMVNPDSDLYRAHPEWALQTENNPHVSFRNQYVLD
LTNPEVVEYLYKVITDVLKAYPKISYIKWDMNRDVNHPGNLHGKPAMHGQMAALYSLIDR
VKAAKPGIEIESCCSGGGRVDLGILPHTDRFWTSDSNDALDRLYIQRGCSYFFPSEVMGA
HVGPRDCHITGRHLPIEIRSAVALFGHMGIEMDPRELTDHEQSVLTDAISLYKKYRHITH
GGDLFRMDDDGMNVKFGYVSKDKQEGIFAYNSVMETVRTTPNRFYFAGLDANKQYTIERV
WPEKLKEYTPSILQQTEGQVFSGEVLMKYGMQLPVLFPQTALIYTVKAV
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcactcacatcattcgttcgtttgtcgaacgagaaagccacattaatattcgac
tgccagggtcgtatgcccaaagtcatttactatggtgcgccattaagtgacagtacaaca
ccagaaatgctgagtgttttaaacacccgtcaagaagccaaatgcgcacccgtaattgaa
ccgccgattacgttggtaccgactcacggtgacggctggacgggtcagccaggtcttgaa
gtgtcgggcgatgccgaccagtggtcagcaggctttagcctgaccgaaataaatgaagat
gcacagtctgttgctttcgtaagcgaagacgctcgccgcggtatgcgtcttatcacaact
gttgagctcgataacaaaacgagcgtagtaaaatacgtttctcgtctcgaaaacagtggc
gaaacaccgctcaatttaggctatttgaatgccgctagcctgcccttgcctacttccgta
agcaaaattaaaacatttgaaggccgctggtcagcagagtttcaaaccaaagatcacgac
ctcttctttggaagttatgtacgtgaaaatcgccgaggcaaaacatctcacgacaccttc
ccaggcctgattgcatttcctcaaggcacgggtgaacttaacggtgagtgctatggttat
caccttggcgcttctgcaaaccacaagcttcgcgctgagctaatggctgatggcagaagc
tatgtgcagtttggtgagttgttatttccaggtgaagtggtacttaacgctggcgaaagc
tatacatcccccgtgctttacacaggctatggctgtgaaggtttctcttcgctatcacaa
cagttccataacttcattcgcagcaacgtgctaaaccacagtgctgaatcgaagcctcgc
ccggtgcactacaacacctgggaaggaatttatttcgatcataacgaagatgaactaaaa
gccttagccgataaagttgcaccactgggtattgagcgctttgtgttagatgatggttgg
tttaaagggcgcagaaacgacaaggctgggcttggcgactggtttgttgatgaagcaatc
taccctgaaggactggacgggctcattgaccatgttactggccttggcatggaattcggt
atttggtttgagccagaaatggtaaaccctgacagtgacctttaccgcgcacaccctgag
tgggcgctgcaaaccgagaataaccctcacgtttctttcagaaatcaatacgtattggat
ttaaccaaccctgaggtggttgagtacctttataaagtgattactgatgtactaaaggcg
taccccaaaatcagctacatcaaatgggacatgaaccgcgacgtaaaccaccccggcaac
cttcacggtaaacctgcgatgcatggtcaaatggctgcgctttacagcttaatagaccgc
gttaaagcagcaaagccaggcattgagatagaaagctgttgttcaggcggcggccgtgta
gatttaggtattttgccacacacagaccgtttctggacatcagactctaacgacgcacta
gatcggttgtatattcagcgtggctgctcatatttcttcccatctgaagtaatgggggca
catgttggcccgcgtgactgccatataacgggtagacacttacccattgagattcgctcg
gcagtcgccttgtttggccatatgggtatagagatggacccacgtgaacttaccgaccac
gagcaaagcgtgcttactgatgctatttcactttacaagaagtatcgtcatatcactcat
ggcggcgaccttttccgcatggacgatgacggcatgaacgtaaaatttggttatgtgtct
aaagacaagcaagaaggtatttttgcatataacagcgttatggaaactgttcgcactacg
ccaaaccgcttctactttgcaggtcttgatgctaacaaacaatacaccattgagcgtgtt
tggcctgaaaagctaaaagaatacaccccgtctattttgcaacaaactgaagggcaggta
ttctctggcgaagtattgatgaaatacggtatgcagctgccggtgctctttccacaaact
gcattgatttacaccgtcaaagcggtgtag

DBGET integrated database retrieval system