KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_00960Help
Entry
AMBAS45_00960     CDS       T02253                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AMBAS45_00960
  Lipid metabolism
   00561 Glycerolipid metabolism
    AMBAS45_00960
   00600 Sphingolipid metabolism
    AMBAS45_00960
Enzymes [BR:amb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AMBAS45_00960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(214274..216403)
Genome map
AA seq 709 aa AA seqDB search
MSSLTSFVRLSNEKATLIFDCQGRMPKVIYYGAPLSDSTTPEMLSVLNTRQEAKCAPVIE
PPITLVPTHGDGWTGQPGLEVSGDADQWSAGFSLTEINEDAQSVAFVSEDARRGMRLITT
VELDNKTSVVKYVSRLENSGETPLNLGYLNAASLPLPTSVSKIKTFEGRWSAEFQTKDHD
LFFGSYVRENRRGKTSHDTFPGLIAFPQGTGELNGECYGYHLGASANHKLRAELMADGRS
YVQFGELLFPGEVVLNAGESYTSPVLYTGYGCEGFSSLSQQFHNFIRSNVLNHSAESKPR
PVHYNTWEGIYFDHNEDELKALADKVAPLGIERFVLDDGWFKGRRNDKAGLGDWFVDEAI
YPEGLDGLIDHVTGLGMEFGIWFEPEMVNPDSDLYRAHPEWALQTENNPHVSFRNQYVLD
LTNPEVVEYLYKVITDVLKAYPKISYIKWDMNRDVNHPGNLHGKPAMHGQMAALYSLIDR
VKAAKPGIEIESCCSGGGRVDLGILPHTDRFWTSDSNDALDRLYIQRGCSYFFPSEVMGA
HVGPRDCHITGRHLPIEIRSAVALFGHMGIEMDPRELTDHEQSVLTDAISLYKKYRHITH
GGDLFRMDDDGMNVKFGYVSKDKQEGIFAYNSVMETVRTTPNRFYFAGLDANKQYTIERV
WPEKLKEYTPSILQQTEGQVFSGEVLMKYGMQLPVLFPQTALIYTVKAV
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcactcacatcattcgttcgtttgtcgaacgagaaagccacattaatattcgac
tgccagggtcgtatgcccaaagtcatttactatggtgcgccattaagtgacagtacaaca
ccagaaatgctgagtgttttaaacacccgtcaagaagccaaatgcgcacccgtaattgaa
ccgccgattacgttggtaccgactcacggtgacggctggacgggtcagccaggtcttgaa
gtgtcgggcgatgccgaccagtggtcagcaggctttagcctgaccgaaataaatgaagat
gcacagtctgttgctttcgtaagcgaagacgctcgccgcggtatgcgtcttatcacaact
gttgagctcgataacaaaacgagcgtagtaaaatacgtttctcgtctcgaaaacagtggc
gaaacaccgctcaatttaggctatttgaatgccgctagcctgcccttgcctacttccgta
agcaaaattaaaacatttgaaggccgctggtcagcagagtttcaaaccaaagatcacgac
ctcttctttggaagttatgtacgtgaaaatcgccgaggcaaaacatctcacgacaccttc
ccaggcctgattgcatttcctcaaggcacgggtgaacttaacggtgagtgctatggttat
caccttggcgcttctgcaaaccacaagcttcgcgctgagctaatggctgatggcagaagc
tatgtgcagtttggtgagttgttatttccaggtgaagtggtacttaacgctggcgaaagc
tatacatcccccgtgctttacacaggctatggctgtgaaggtttctcttcgctatcacaa
cagttccataacttcattcgcagcaacgtgctaaaccacagtgctgaatcgaagcctcgc
ccggtgcactacaacacctgggaaggaatttatttcgatcataacgaagatgaactaaaa
gccttagccgataaagttgcaccactgggtattgagcgctttgtgttagatgatggttgg
tttaaagggcgcagaaacgacaaggctgggcttggcgactggtttgttgatgaagcaatc
taccctgaaggactggacgggctcattgaccatgttactggccttggcatggaattcggt
atttggtttgagccagaaatggtaaaccctgacagtgacctttaccgcgcacaccctgag
tgggcgctgcaaaccgagaataaccctcacgtttctttcagaaatcaatacgtattggat
ttaaccaaccctgaggtggttgagtacctttataaagtgattactgatgtactaaaggcg
taccccaaaatcagctacatcaaatgggacatgaaccgcgacgtaaaccaccccggcaac
cttcacggtaaacctgcgatgcatggtcaaatggctgcgctttacagcttaatagaccgc
gttaaagcagcaaagccaggcattgagatagaaagctgttgttcaggcggcggccgtgta
gatttaggtattttgccacacacagaccgtttctggacatcagactctaacgacgcacta
gatcggttgtatattcagcgtggctgctcatatttcttcccatctgaagtaatgggggca
catgttggcccgcgtgactgccatataacgggtagacacttacccattgagattcgctcg
gcagtcgccttgtttggccatatgggtatagagatggacccacgtgaacttaccgaccac
gagcaaagcgtgcttactgatgctatttcactttacaagaagtatcgtcatatcactcat
ggcggcgaccttttccgcatggacgatgacggcatgaacgtaaaatttggttatgtgtct
aaagacaagcaagaaggtatttttgcatataacagcgttatggaaactgttcgcactacg
ccaaaccgcttctactttgcaggtcttgatgctaacaaacaatacaccattgagcgtgtt
tggcctgaaaagctaaaagaatacaccccgtctattttgcaacaaactgaagggcaggta
ttctctggcgaagtattgatgaaatacggtatgcagctgccggtgctctttccacaaact
gcattgatttacaccgtcaaagcggtgtag

DBGET integrated database retrieval system