KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_01455Help
Entry
AMBAS45_01455     CDS       T02253                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:amb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMBAS45_01455
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AMBAS45_01455
Enzymes [BR:amb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AMBAS45_01455
Two-component system [BR:amb02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AMBAS45_01455
Bacterial motility proteins [BR:amb02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AMBAS45_01455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
323957..325003
Genome map
AA seq 348 aa AA seqDB search
MPIKVLVVDDSALIRQILSEIVTRDPGLVLVGAAPDAYAAKRMVQEFRPDVITLDIEMPK
VDGLRFLEVMMKAMPTPVVMISTLTERGADATLRALELGAVDFMAKPKLGVAQGMAEYAA
VIVEKIKAAAHSRLGQPTQTRCTKHASMRYAGTEKLIGIGASTGGTEAIKDVIMHFPRNA
PATIISQHMPPGFTTTYAKRLDSLCEITVREAHGGERLLPGFAYLAPGNKHLKIERSGAD
YRLTLDDGPKVSGHKPSVDVMFDSLAEHAGANAVGVLLTGMGRDGAKGLKSMHTKGSVTF
CQDEKTCVVYGMPKVAVEMKAASFIKPLEDISDAILDTLEALGAGSRL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcctataaaagtcctcgtggttgatgactctgcgttgatccgccaaattctttcagaa
atagtaacccgtgatccaggtttagtgcttgtgggggcggcgcctgatgcttatgcggca
aagcgaatggtgcaagagttcaggccagacgttattactctggacattgaaatgccgaag
gtagacgggttacgttttttagaagtaatgatgaaggcgatgccgaccccagttgtgatg
atatctacgctgactgaaagaggtgccgacgcaacactgcgtgcgctcgaactaggcgct
gtggattttatggcaaagccaaagctcggcgtagcgcaaggtatggctgaatacgcggcg
gttattgttgaaaagataaaagcagcagcgcattcgaggttaggccaaccaacgcaaaca
cgctgcacaaaacatgcttctatgcgctacgcaggaaccgaaaagttaattggtataggc
gcatcaactgggggaactgaagcaataaaagacgttatcatgcattttccccgcaatgca
ccggccaccattatttcccaacacatgcctccagggttcacaactacttacgccaagcgg
ctcgatagcctttgtgaaataaccgtgagagaagcgcacggaggggagcgtttattgcct
ggatttgcgtacttggcaccaggtaataaacatttaaaaatagagcgtagcggcgctgac
tatcgtttaacccttgatgatggccctaaggtatcaggacacaagccctctgttgatgtg
atgtttgactcgctggctgagcatgctggcgcaaacgcggtgggtgtgctgcttacgggc
atgggacgggatggagcaaaaggccttaagagtatgcacacgaaaggctctgttacgttt
tgtcaggatgaaaaaacctgcgttgtttacggtatgcctaaagtggctgtagaaatgaaa
gccgcgagttttatcaagccgttagaagacatctcagatgcaattctagatacgcttgaa
gcattgggcgcgggctcgcgcctttaa

DBGET integrated database retrieval system