KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_02120Help
Entry
AMBAS45_02120     CDS       T02253                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AMBAS45_02120
Enzymes [BR:amb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AMBAS45_02120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
484592..485569
Genome map
AA seq 325 aa AA seqDB search
MNWTFTSENNLASTFATYINPFWQNSVTQGHFSGKDNIKVRFAHCIPESPRATIVICSGR
IESYLKYKEFIYDLYQNGFAVFILDHRGQGLSDRMTRDPQHGYVADFDDYVDDFVMFVET
IVKPLQQGPLQLVCHSMGGAIGALTLLRLPNLFSKAVLASPMFGIKPALPNWLANGLIRT
GLAVNRLKKKDAGYFFGQTPYIAFPFSLNKLTHSKTRYALFRELYDEEQDIQLGGVTTEW
LAAAHQAMNKIESSARAITTPSLVLSADDDAIIDNNRQRRVAQLMPNAKLEIVPRAYHEL
FTESDDIRERSMARILDFLTEDSST
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaactggacgttcacgtctgaaaataacttagccagcacttttgccacgtatatcaat
cccttctggcaaaacagtgttactcagggccacttctctgggaaagacaatatcaaggta
cgctttgcgcactgtatcccagaatcgccgcgagctaccattgtaatatgctctggtcga
atcgaatcttatttaaagtacaaagagttcatttacgatctctatcaaaatggtttcgca
gtattcatcttagatcacagagggcaaggtttgtcagacaggatgacccgtgaccctcag
catggttatgttgccgattttgacgactacgttgatgacttcgtcatgttcgtagaaact
attgtaaagccactgcagcaaggcccgttacagctggtatgccattcgatggggggcgcc
attggtgcactcacgctgctgcgtcttccgaatttgttttcaaaagccgttttagcttcg
cccatgtttggcattaaacccgctctgcccaattggttggcgaatggcttaattcgcaca
ggccttgcggtaaacaggttgaaaaagaaagatgcggggtacttttttggtcaaaccccg
tatatcgcgtttcctttttcacttaataagctcacccacagcaaaacccgctatgcgctg
ttccgtgaactgtatgacgaagagcaggatattcagcttggtggcgtgactacagagtgg
ttggccgcggcacatcaggctatgaacaaaattgaaagtagcgcacgcgctattacaacg
ccctcgcttgtattaagtgcagacgatgacgcgattattgataataaccgtcagcgccgc
gtggcgcagcttatgccaaatgcaaaacttgaaatagtgccccgcgcttaccatgagcta
ttcaccgagtctgacgacattcgcgagcgctccatggcgcgtattctcgactttttgaca
gaagactcgtctacataa

DBGET integrated database retrieval system