KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_02430Help
Entry
AMBAS45_02430     CDS       T02253                                 

Definition
beta-hexosaminidase A
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMBAS45_02430
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AMBAS45_02430
Enzymes [BR:amb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AMBAS45_02430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
557528..559501
Genome map
AA seq 657 aa AA seqDB search
MLFQQVICKKRASLMGLSAILSGILILLSASLFTASATAQSGSANASNNPKPSADAETIR
AVKNMLGQKIILDFRYFCEGNTPSSRCRTPMTVIPPSLLNVLSTHNIGGVILFSENIQNT
EQLITLNYTMQQHMVKAGRQPLFIAVDQEGGRVARLPSDMLSPFAGNMAIGATFHQRGSA
FAQSVASHIGQTLLPLGINTNFAPSVDVNSEPKNPVINVRSFSENPEQVAALGQTFVSAM
QSAGVMSAIKHFPGHGDTHVDSHSGLPQVMHSKAQAMAGDILPFAHIINSATPPAMVMSA
HIQYPSLDDTTIIDKHGKSQIVPATLSKKILSNLLRNQLGYQGLIVTDALDMAGITQFFS
HEEALVSAFSAGADIALMPFTIRTQDDIKKFALLLDNAVSRMSESAFLKASHNRIIKAKQ
RFALQSFISKPMSWWLNEAKENASMNNPNSLKNRGIQIEKALSKSSVSVLSGKDKLPINS
NRWLALMPDAARCLAFEAALTRARSNFNNKTLEFACLPLTALPKTQLAMNLLKQADVLMV
GNISPLHANYELGGVDLPEHVKRRASETEVMAFSKKIMVAAKAQNKTVVFAPLRMPYKAH
DVKELADVAIATFSYAVNITQQSDKENQHVTSYSLNALVDVLLGSALAEGRSPVSLK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
ttgttattccagcaagttatttgtaaaaaacgtgcttcgttgatgggccttagcgctatc
ttgtcaggcatactcattttattaagtgcttcactgtttactgctagcgcaaccgctcaa
tctggaagtgctaacgcttcgaataatcctaagcccagcgctgatgccgaaacaattcgc
gctgtaaaaaacatgctcgggcaaaaaatcattttggattttcgctatttctgtgagggc
aatacgccgtcttcgcgctgccgtacgcccatgaccgtaattccaccgtcacttttaaat
gtgcttagtacgcacaacatcggcggtgttattttgttttcagagaatattcaaaatacc
gagcagttaataacgctcaattacaccatgcagcagcatatggtaaaagcaggtcgtcag
ccgttgtttattgctgtcgatcaagaagggggcagagtagcaaggttgccttcagacatg
ctctcgccgtttgcgggtaacatggccattggcgccacttttcatcagcgaggcagcgca
tttgcgcaaagtgtggcatcgcatattggccaaacgcttttaccgctgggaataaacacc
aattttgcgccgtcggttgatgtaaatagcgagccgaagaaccctgttattaacgtacgc
agtttttcggaaaacccagagcaggtagccgcactcgggcagacatttgtcagtgctatg
caaagtgcaggtgtaatgagtgctatcaaacattttccaggccatggtgatacccatgta
gatagccacagcggcttaccgcaagtaatgcatagcaaagcgcaagctatggcgggtgac
atccttccttttgcgcatatcattaatagtgcaacgcctcctgcaatggtaatgagtgca
catattcagtacccgtctttagacgatacgacaattattgataagcatggtaagtcacaa
atagttcctgctactttgtcgaagaagatactaagcaatttgcttcgcaaccaattagga
tatcaaggccttatcgttactgacgcgttagacatggcaggtattactcagtttttctcc
catgaagaagcattagtcagtgcattcagcgcaggtgctgacatagcgctaatgccgttc
accataagaacccaagacgacataaaaaagttcgcgttacttttggataatgcagtaagt
cgaatgtcggaaagcgctttcttgaaagcgtctcataatcgtattattaaggcaaaacag
cgctttgctttgcaaagttttatttccaagcccatgtcatggtggctcaatgaagcgaaa
gaaaatgcttcaatgaataaccctaacagtttgaaaaacagaggaattcaaattgagaaa
gcgctttctaaatcgtcggtatctgtactctccggtaaggataagttgccaataaattca
aatcgctggttggcgctcatgccagacgcggcaagatgtttagcatttgaagccgcgctt
acgcgcgcacgttccaacttcaacaataagactctggagtttgcgtgtttgccgttaact
gcgctacctaaaacccaattagcaatgaatctattaaaacaagctgacgtgctgatggtt
ggcaatattagccctctacatgctaactatgaattaggaggagtcgatttacctgagcat
gtgaaacgacgcgcgagcgagactgaggtgatggcatttagcaaaaaaataatggttgct
gcgaaagcacagaataaaaccgtggtctttgctccactgcgcatgccatacaaagcgcat
gacgtgaaagagctagccgatgttgctattgctacatttagttatgcggtgaacattaca
cagcaaagtgacaaagaaaatcagcacgttacgagctatagtcttaatgctttggttgat
gtattactcggtagcgcgctcgctgagggacgttcacctgtttcgttgaaatag

DBGET integrated database retrieval system