KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_03230Help
Entry
AMBAS45_03230     CDS       T02253                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMBAS45_03230
Enzymes [BR:amb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AMBAS45_03230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
739802..740296
Genome map
AA seq 164 aa AA seqDB search
MSQHTILISIGSNIEREHYTKQSLVALKQHFSDVAVSSVYESEAVGFNGSPFYNAAARAT
TSKSIEEVCAILKAIEKDNGRVHTDKKFCARTLDLDLLTYDSKVTTTPVVLPREEICYNA
FVLWPLAELVPNDIHPETQETYAKMWQNFDKQKQQLWPIDFTWS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacacaccatcttaatcagcattggctctaatattgaacgtgagcattacacc
aagcaatcattagttgccctgaaacagcacttctcagatgttgcagtgtcttcggtctac
gagagcgaagcggtgggcttcaatggaagccctttttataacgccgctgctcgggcgacg
acatcaaaaagtatagaagaggtgtgcgcaattcttaaagccattgaaaaagacaatggt
agggtgcatacagacaaaaaattctgtgccagaacccttgatctcgacttgcttacctat
gatagtaaggtgaccacaacccctgtggttttacctcgcgaagagatttgctacaacgcg
tttgtgctttggccgttagctgaacttgttcccaacgacattcaccctgaaacgcaagaa
acctatgccaaaatgtggcaaaactttgataaacagaaacagcaattatggccgattgac
tttacttggagttaa

DBGET integrated database retrieval system