KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_03465Help
Entry
AMBAS45_03465     CDS       T02253                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Brite
Enzymes [BR:amb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AMBAS45_03465
Secretion system [BR:amb02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   AMBAS45_03465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
801327..802130
Genome map
AA seq 267 aa AA seqDB search
MERYRFKQLHVKPVSTNELKWQDGEYLVKAVKKVLLASVVAAGSLLGLSAQAADEAAIRD
KLTSMLGLDVETIADSPVSGLVQVSTNRGLFYVSENGQYLLQARVFNIDEEMRNETELAL
SGLRKEGVKEMESSSITFKAKNEKHEISVFTDITCGYCRKFHNEIDELNDAGITVHYLAF
PRSGLNSENYNDMVSVWCAKDPQKALTKAKAGNDVASASCKNKVAEQYMLGQKLGVNGTP
NIVLPDGSLIPGYQPAALLAKALEEAE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaaagataccgattcaagcagttgcatgttaagccagtaagtacaaacgaacttaaa
tggcaagatggagagtatttagtgaaagcagtaaagaaagtattgttagccagtgtagtt
gcggcaggttctctattagggcttagtgcgcaagcggctgatgaagcggctatccgtgat
aaattaacctcaatgctagggttagatgtagaaaccattgctgactctccagtatcaggg
ctggttcaggtatcaacaaaccgcggtttattttacgtaagtgaaaacgggcagtatctg
cttcaggctcgtgtttttaacattgatgaagagatgcgtaacgaaacagagctggcactt
tctgggctgcgcaaagagggcgtaaaagagatggagtcatcgtctattacgtttaaggcc
aaaaacgaaaagcatgaaataagcgtatttaccgatattacgtgtggttactgccgtaaa
tttcacaacgagattgatgaactcaacgatgcgggtattaccgtacactaccttgcgttt
ccacgttctgggttaaacagtgaaaactacaacgatatggtgtcggtgtggtgtgcgaaa
gacccgcaaaaagcgttaactaaagctaaagcgggtaacgacgtagctagcgcaagctgt
aaaaataaagtggcagagcagtacatgttaggtcaaaaattaggcgtgaatggcacgcca
aatatcgtactgccagacggttcattgattcctggttatcagccagctgcgttgcttgct
aaagcattggaggaagctgaatag

DBGET integrated database retrieval system