KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_03775Help
Entry
AMBAS45_03775     CDS       T02253                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:amb00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:amb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
862069..863331
Genome map
AA seq 420 aa AA seqDB search
MDKLVIKKGPALNGTVRISGAKNAALPLLMTSLLTDSPCRYTNVPRLRDINTTTALLREL
GVEVALPAPNDIVIDASTLQSVTASYELVRTMRASILVLGPLLAKQGKANVSLPGGCAIG
ARPVNLHLTGLEKMGAKIEVDEGYIRAEVDGRLKGARIFMDMVSVGATENLLMAAALADG
TTILENAAREPEIVDLANCLIQMGAKISGAGSDKITIEGVETLNGCDYAVLPDRIETGTF
LVAAAVTGGKIRCTHAAPDTLDAVLDKLEQAGAKITTGDDWIELDMEGRKPQAVRVKTAP
HPAFPTDMQAQFVTLNCVAEGTGVITETIFENRFMHVPELQRMGAEIALEANSAVSKGSS
SLKGAPVMATDLRASASLVIAGLIAEGETHVNRIYHLDRGYEAIEEKLGGLGAIIERVKE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggataaactcgtaattaaaaagggccctgcgctcaacggtaccgtgcgcatctctggc
gctaaaaacgcggccttgccattgttgatgacaagcttgctgaccgactctccttgtcgt
tacaccaacgttcctcgtcttcgtgacatcaatactacgacggcacttttgcgtgaatta
ggggttgaagtcgcactacctgcacctaacgatatcgttatcgatgcgagtacgctacaa
agcgttacggcgtcctatgagttagtacgtactatgcgtgcgtctatcttggtacttggc
ccattgctagctaagcaaggtaaagcgaatgtctctttgcccggtggctgtgctataggt
gcgcgcccggtaaatcttcatttaactggccttgaaaagatgggcgcgaagattgaagta
gacgaaggctacattcgagccgaagtcgatggtcgtctgaaaggtgcgcgtattttcatg
gatatggtaagcgtgggtgccactgaaaacctactgatggcagcggcgctggctgacgga
acaaccattcttgaaaacgcggcacgcgagcccgaaatcgttgatttagcaaattgtctt
attcagatgggcgcgaaaattagcggtgcaggaagcgataaaataactattgagggcgtg
gaaaccttaaacggttgtgattatgcagtgctgcctgaccgtatagaaaccggtactttc
ttggtagcggccgctgtgacaggtgggaaaatacgctgtactcatgcggcgccagataca
ttagatgcggtgctagataagctagagcaggccggagctaaaatcaccactggtgatgac
tggatagagctagacatggaagggcgcaaaccgcaggctgtgcgagttaaaaccgcacca
cacccagcattccctacggatatgcaggcgcagtttgttaccttgaactgtgttgccgaa
ggcacgggcgtaattacagaaaccatttttgaaaaccgcttcatgcacgtgccagagtta
caacgtatgggcgcagaaatcgcattagaagcaaactcagcagtgtctaaaggcagctca
agtcttaaaggagctccggtaatggccactgacctgcgcgcgtcggcaagcttggtgata
gctgggctcatcgcagaaggtgagactcacgtgaatcgcatttatcacttagaccgtggt
tatgaagccattgaagagaagctgggtggcttgggtgccatcattgaaagagtgaaagaa
taa

DBGET integrated database retrieval system