KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_04270Help
Entry
AMBAS45_04270     CDS       T02253                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
994941..995990
Genome map
AA seq 349 aa AA seqDB search
MILGACSKSPTPYIWNLPHNIPPPPVPADNPVTEESVILGEKLFFDKGLSANNTVSCSSC
HEPEHAFSEPKTVSVGANGDALNRNALALVNVAYNASFTWAHNNLESIEKQLMIPLFNEH
PVEMGVTGNEKRILKRFEGSEYRALFQAAYGDDTPNLNNIVKALASYVRSLVSFSSAFDN
YAYAQDDDALTAQQLEGLNLFFSERTECFHCHGGLNFTQSSKHSFQPFAAQPFHNTGLYN
EDGKGSYPESDMGLYSVTHNKQDMGKFRAPTLRNIALTAPYMHDGSIATLDEVIEFYARG
GNLAESPNPYRSPFIKGFMISEDEKAALVAFLRSLTDEQFVKTHTTRKN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgattttaggagcgtgcagtaaatcgcccacgccttacatttggaatttgcctcacaat
attccaccgcctcccgttcccgcagacaatcctgtgaccgaagaaagcgtaattttggga
gagaagcttttctttgataagggcttaagtgctaacaatacggtttcatgcagcagctgc
catgaaccagagcatgctttctctgaacctaagacggtttcagtaggcgcgaacggagac
gcgctaaaccgtaacgcattagcgctagtaaacgtggcttataatgcatccttcacttgg
gcgcataacaatttagaaagtatagaaaagcagctgatgatcccgctttttaatgaacat
cctgtggaaatgggcgttacgggaaatgaaaagcgtatattaaagcgctttgagggcagc
gaatatcgagcgctttttcaagcggcttatggtgatgatacacccaatttaaacaatatt
gtaaaggcgcttgctagctacgtaagaagtttagtgtcgtttagtagtgcttttgataac
tacgcttacgctcaagatgacgatgcacttaccgcccagcagcttgaaggtttgaatctg
tttttttcagagcgcactgagtgctttcactgccacggaggtctgaactttactcaatcg
tctaagcatagttttcaaccttttgcggctcagcctttccacaacactggcctgtataat
gaagatgggaagggcagttatccggaatcggacatggggctttacagcgttactcacaat
aaacaagacatggggaagtttagagcacctactttgcgcaatatagcccttactgcgccc
tacatgcatgatggcagtattgccacccttgatgaagtcattgagttttatgctcgtggg
ggaaatctggctgaaagccctaacccttaccgtagtccgttcataaaaggctttatgatt
tctgaagatgaaaaggcggcgttggttgcatttttgcgcagtttaaccgacgagcaattt
gtaaaaacacacactacacgcaaaaattag

DBGET integrated database retrieval system